Anti-IL7R alpha Antibody Picoband™

IL-7R alpha/CD127 antibody

Boster Bio Anti-IL7R alpha Antibody Picoband™ catalog # PB9948. Tested in Flow Cytometry, WB applications. This antibody reacts with Human, Rat.

Product Info Summary

SKU: PB9948
Size: 100 μg/vial
Reactive Species: Human, Rat
Host: Rabbit
Application: Flow Cytometry, WB

Product Name

Anti-IL7R alpha Antibody Picoband™

View all IL-7R alpha/CD127 Antibodies

SKU/Catalog Number

PB9948

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-IL7R alpha Antibody Picoband™ catalog # PB9948. Tested in Flow Cytometry, WB applications. This antibody reacts with Human, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-IL7R alpha Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9948)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha, different from the related mouse sequence by nine amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9948 is reactive to IL7R in Human, Rat

Applications

PB9948 is guaranteed for Flow Cytometry, WB Boster Guarantee

Observed Molecular Weight

70 kDa

Calculated molecular weight

51.579kDa

Background of IL-7R alpha/CD127

The interleukin-7 receptor, also known as IL7R alpha, is a protein found on the surface of cells. It is mapped to 5p13. Interleukin-7 receptor has been shown to play a critical role in the development of immune cells called lymphocytes - specifically in a process known as V (D)J recombination. This protein is also found to control the accessibility of a region of the genome that contains the T-cell receptor gamma gene, by STAT5 and histone acetylation. Knockout studies in mice suggest that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes. Functional defects in this protein may be associated with the pathogenesis of severe combined immunodeficiency (SCID).

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Rat
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For IL7R (Source: Uniprot.org, NCBI)

Gene Name

IL7R

Full Name

Interleukin-7 receptor subunit alpha

Weight

51.579kDa

Superfamily

type I cytokine receptor family

Alternative Names

CD127 antigen; CD127; CD127ILRA; CDW127; IL-7 R alpha; IL-7 receptor subunit alpha; IL7R alpha; IL-7R alpha; IL-7R subunit alpha; IL7R; IL7RA; IL-7Ra; IL-7R-alpha; interleukin 7 receptor alpha chain; interleukin 7 receptor isoform H5-6; interleukin 7 receptor; interleukin-7 receptor subunit alpha IL7R CD127, CDW127, IL-7R-alphaA, ILRA, IL7R interleukin 7 receptor interleukin-7 receptor subunit alpha|CD127 antigen|IL-7 receptor subunit alpha|IL-7R subunit alpha|interleukin 7 receptor alpha chain

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on IL7R, check out the IL7R Infographic

IL7R infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IL7R: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB9948

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-IL7R alpha Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-IL7R alpha Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

3 Customer Q&As for Anti-IL7R alpha Antibody Picoband™

Question

We are currently using anti-IL7R alpha antibody PB9948 for human tissue, and we are well pleased with the Flow Cytometry results. The species of reactivity given in the datasheet says human, rat. Is it true that the antibody can work on pig tissues as well?

K. Parker

Verified customer

Asked: 2019-08-06

Answer

The anti-IL7R alpha antibody (PB9948) has not been tested for cross reactivity specifically with pig tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-08-06

Question

Is this PB9948 anti-IL7R alpha antibody reactive to the isotypes of IL7R?

Verified Customer

Verified customer

Asked: 2017-09-26

Answer

The immunogen of PB9948 anti-IL7R alpha antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha (278-315aa DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ), different from the related mouse sequence by nine amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2017-09-26

Question

PB9948 PB9199 Could you let me know if these will pass FLOW?

Verified Customer

Verified customer

Asked: 2014-12-26

Answer

PB9948 passed FLOW. PB9919 failed.

Boster Scientific Support

Answered: 2014-12-26

Order DetailsPrice
PB9948

100μg

$370
PB9948-10ug

10μg sample (liquid)

$99
PB9948-Biotin

100 μg Biotin conjugated

$570
PB9948-Cy3

100 μg Cy3 conjugated

$570
PB9948-Dylight488

100 μg Dylight488 conjugated

$570
PB9948-Dylight550

100 μg Dylight550 conjugated

$570
PB9948-Dylight594

100 μg Dylight594 conjugated

$570
PB9948-FITC

100 μg FITC conjugated

$570
PB9948-HRP

100 μg HRP conjugated

$570
PB9948-APC

100 μg APC conjugated

$670
PB9948-PE

100 μg PE conjugated

$670
PB9948-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9948
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.