Anti-PIM1 Antibody Picoband™

PIM1 antibody

Boster Bio Anti-PIM1 Antibody Picoband™ catalog # PB9315. Tested in WB applications. This antibody reacts with Human. Cited in 1 publication(s).

Product Info Summary

SKU: PB9315
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: WB

Product Name

Anti-PIM1 Antibody Picoband™

View all PIM1 Antibodies

SKU/Catalog Number

PB9315

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-PIM1 Antibody Picoband™ catalog # PB9315. Tested in WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-PIM1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9315)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human PIM1, different from the related mouse sequence by seven amino acids and from the related rat sequence by two amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9315 is reactive to PIM1 in Human

Applications

PB9315 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

44 kDa

Calculated molecular weight

35.686kDa

Background of PIM1

Proto-oncogene serine/threonine-protein kinase Pim-1 is an enzyme that in humans is encoded by the PIM1 gene. It is mapped to 6p21.2. Primarily expressed in spleen, thymus, bone marrow, prostate, oral epithelial, hippocampus and fetal liver cells, Pim-1 has also been found to be highly expressed in cell cultures isolated from human tumors. Pim-1 is mainly involved in cell cycle progression, apoptosis and transcriptional activation, as well as more general signal transduction pathways. It has been found a physiologic role of the PIM1 oncogene during hematopoietic development and a deregulation of the gene in various leukemias. PIM1 also has a role in cardioprotection downstream of AKT activation.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For PIM1 (Source: Uniprot.org, NCBI)

Gene Name

PIM1

Full Name

Serine/threonine-protein kinase pim-1

Weight

35.686kDa

Superfamily

protein kinase superfamily

Alternative Names

EC 2.7.11.1; Oncogene PIM1; PIM; pim-1 kinase 44 kDa isoform; pim-1 oncogene (proviral integration site 1); pim-1 oncogene; PIM1; proto-oncogene serine/threonine-protein kinase pim-1 PIM1 PIM Pim-1 proto-oncogene, serine/threonine kinase serine/threonine-protein kinase pim-1|Oncogene PIM1|pim-1 oncogene (proviral integration site 1)|proto-oncogene serine/threonine-protein kinase pim-1

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on PIM1, check out the PIM1 Infographic

PIM1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PIM1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

PB9315 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

PIM1 polymorphism and PIM1 expression as predisposing factors of esophageal squamous cell carcinoma in the Asian population

Have you used Anti-PIM1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-PIM1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

15 Customer Q&As for Anti-PIM1 Antibody Picoband™

Question

Here is the WB image, lot number and protocol we used for lower esophagus mucosa using anti-PIM1 antibody PB9315. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2020-01-22

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-01-22

Question

We are currently using anti-PIM1 antibody PB9315 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on horse tissues as well?

Verified Customer

Verified customer

Asked: 2020-01-17

Answer

The anti-PIM1 antibody (PB9315) has not been tested for cross reactivity specifically with horse tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-01-17

Question

you antibody to test anti-PIM1 antibody PB9315 on human lower esophagus mucosa for research purposes, then I may be interested in using anti-PIM1 antibody PB9315 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-11-05

Answer

The products we sell, including anti-PIM1 antibody PB9315, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-11-05

Question

Is a blocking peptide available for product anti-PIM1 antibody (PB9315)?

Verified Customer

Verified customer

Asked: 2019-08-27

Answer

We do provide the blocking peptide for product anti-PIM1 antibody (PB9315). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-08-27

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for lower esophagus mucosa using anti-PIM1 antibody PB9315. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-08-26

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-08-26

Question

We have observed staining in human lower esophagus mucosa. Any tips? Is anti-PIM1 antibody supposed to stain lower esophagus mucosa positively?

Verified Customer

Verified customer

Asked: 2019-08-26

Answer

According to literature lower esophagus mucosa does express PIM1. According to Uniprot.org, PIM1 is expressed in lower esophagus mucosa, kidney, erythroleukemia, among other tissues. Regarding which tissues have PIM1 expression, here are a few articles citing expression in various tissues:
Erythroleukemia, Pubmed ID: 23186163
Kidney, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2019-08-26

Question

I see that the anti-PIM1 antibody PB9315 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-08-15

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-08-15

Question

Is there a BSA free version of anti-PIM1 antibody PB9315 available?

Verified Customer

Verified customer

Asked: 2019-05-27

Answer

Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-PIM1 antibody PB9315 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-05-27

Question

I am looking for using your anti-PIM1 antibody for positive regulation of cardioblast proliferation studies. Has this antibody been tested with western blotting on a549 whole cell lysates? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2019-05-16

Answer

We appreciate your inquiry. This PB9315 anti-PIM1 antibody is tested on human a549, u2os whole cell lysates, a549 whole cell lysates. It is guaranteed to work for WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2019-05-16

Question

Is this PB9315 anti-PIM1 antibody reactive to the isotypes of PIM1?

A. Jha

Verified customer

Asked: 2018-02-02

Answer

The immunogen of PB9315 anti-PIM1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human PIM1(373-404aa EEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK), different from the related mouse sequence by seven amino acids and from the related rat sequence by two amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-02-02

Question

Our team were well pleased with the WB result of your anti-PIM1 antibody. However we have been able to see positive staining in kidney isoform 1: cytoplasm. nucleus. using this antibody. Is that expected? Could you tell me where is PIM1 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2017-12-20

Answer

Based on literature, kidney does express PIM1. Generally PIM1 expresses in isoform 1: cytoplasm. nucleus., isoform 2: cell membrane. Regarding which tissues have PIM1 expression, here are a few articles citing expression in various tissues:
Erythroleukemia, Pubmed ID: 23186163
Kidney, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2017-12-20

Question

I was wanting to use your anti-PIM1 antibody for WB for human lower esophagus mucosa on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human lower esophagus mucosa identification?

Verified Customer

Verified customer

Asked: 2017-11-03

Answer

It shows on the product datasheet, PB9315 anti-PIM1 antibody has been validated for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human lower esophagus mucosa in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-11-03

Question

Can you help my question with product PB9315, anti-PIM1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

M. Zhang

Verified customer

Asked: 2015-07-24

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9315 anti-PIM1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2015-07-24

Question

Does anti-PIM1 antibody PB9315 work for WB with lower esophagus mucosa?

G. Huang

Verified customer

Asked: 2015-03-10

Answer

According to the expression profile of lower esophagus mucosa, PIM1 is highly expressed in lower esophagus mucosa. So, it is likely that anti-PIM1 antibody PB9315 will work for WB with lower esophagus mucosa.

Boster Scientific Support

Answered: 2015-03-10

Question

Would PB9315 anti-PIM1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

V. Bhatt

Verified customer

Asked: 2013-09-18

Answer

As indicated on the product datasheet, PB9315 anti-PIM1 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2013-09-18

Order DetailsPrice
PB9315

100μg

$370
PB9315-10ug

10μg sample (liquid)

$99
PB9315-Biotin

100 μg Biotin conjugated

$570
PB9315-Cy3

100 μg Cy3 conjugated

$570
PB9315-Dylight488

100 μg Dylight488 conjugated

$570
PB9315-Dylight550

100 μg Dylight550 conjugated

$570
PB9315-Dylight594

100 μg Dylight594 conjugated

$570
PB9315-FITC

100 μg FITC conjugated

$570
PB9315-HRP

100 μg HRP conjugated

$570
PB9315-APC

100 μg APC conjugated

$670
PB9315-PE

100 μg PE conjugated

$670
PB9315-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9315
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.