Anti-Proteasome 20S alpha 2/PSMA2 Antibody Picoband™

PSMA2 antibody

Boster Bio Anti-Proteasome 20S alpha 2/PSMA2 Antibody Picoband™ catalog # PB10088. Tested in WB applications. This antibody reacts with Human, Rat.

Product Info Summary

SKU: PB10088
Size: 100 μg/vial
Reactive Species: Human, Rat
Host: Rabbit
Application: WB

Product Name

Anti-Proteasome 20S alpha 2/PSMA2 Antibody Picoband™

View all PSMA2 Antibodies

SKU/Catalog Number

PB10088

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Proteasome 20S alpha 2/PSMA2 Antibody Picoband™ catalog # PB10088. Tested in WB applications. This antibody reacts with Human, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Proteasome 20S alpha 2/PSMA2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10088)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human PSMA2, identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB10088 is reactive to PSMA2 in Human, Rat

Applications

PB10088 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

26 kDa

Calculated molecular weight

25.899kDa

Background of PSMA2

Proteasome subunit alpha type-2 is a protein that in humans is encoded by the PSMA2 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Rat

Validation Images & Assay Conditions

Gene/Protein Information For PSMA2 (Source: Uniprot.org, NCBI)

Gene Name

PSMA2

Full Name

Proteasome subunit alpha type-2

Weight

25.899kDa

Superfamily

peptidase T1A family

Alternative Names

HC3; MU; PMSA2; PSC3; PSMA2 PSMA2 HC3, MU, PMSA2, PSC2 proteasome 20S subunit alpha 2 proteasome subunit alpha type-2|macropain subunit C3|multicatalytic endopeptidase complex subunit C3|proteasome (prosome, macropain) subunit, alpha type, 2|proteasome component C3|proteasome subunit HC3|proteasome subunit alpha 2

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on PSMA2, check out the PSMA2 Infographic

PSMA2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PSMA2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB10088

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Proteasome 20S alpha 2/PSMA2 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-Proteasome 20S alpha 2/PSMA2 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-Proteasome 20S alpha 2/PSMA2 Antibody Picoband™

Question

I was wanting to use your anti-Proteasome 20S alpha 2/PSMA2 antibody for WB for human kidney on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human kidney identification?

Verified Customer

Verified customer

Asked: 2019-12-04

Answer

You can see on the product datasheet, PB10088 anti-Proteasome 20S alpha 2/PSMA2 antibody has been validated for WB on human, rat tissues. We have an innovator award program that if you test this antibody and show it works in human kidney in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-12-04

Question

My question regarding product PB10088, anti-Proteasome 20S alpha 2/PSMA2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-10-21

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB10088 anti-Proteasome 20S alpha 2/PSMA2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-10-21

Question

Is this PB10088 anti-Proteasome 20S alpha 2/PSMA2 antibody reactive to the isotypes of PSMA2?

H. Jones

Verified customer

Asked: 2019-04-19

Answer

The immunogen of PB10088 anti-Proteasome 20S alpha 2/PSMA2 antibody is A synthetic peptide corresponding to a sequence in the middle region of human PSMA2 (82-123aa DYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYT Q), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-04-19

Question

Will anti-Proteasome 20S alpha 2/PSMA2 antibody PB10088 work on feline WB with brain cajal-retzius cell?

Verified Customer

Verified customer

Asked: 2019-03-27

Answer

Our lab technicians have not tested anti-Proteasome 20S alpha 2/PSMA2 antibody PB10088 on feline. You can run a BLAST between feline and the immunogen sequence of anti-Proteasome 20S alpha 2/PSMA2 antibody PB10088 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated feline samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in feline brain cajal-retzius cell in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-03-27

Question

Will PB10088 anti-Proteasome 20S alpha 2/PSMA2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

S. Carter

Verified customer

Asked: 2018-06-04

Answer

As indicated on the product datasheet, PB10088 anti-Proteasome 20S alpha 2/PSMA2 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2018-06-04

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for kidney using anti-Proteasome 20S alpha 2/PSMA2 antibody PB10088. Let me know if you need anything else.

S. Carter

Verified customer

Asked: 2016-05-13

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2016-05-13

Question

We are currently using anti-Proteasome 20S alpha 2/PSMA2 antibody PB10088 for human tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, rat. Is it possible that the antibody can work on canine tissues as well?

M. Edwards

Verified customer

Asked: 2015-08-28

Answer

The anti-Proteasome 20S alpha 2/PSMA2 antibody (PB10088) has not been tested for cross reactivity specifically with canine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2015-08-28

Order DetailsPrice
PB10088

100μg

$370
PB10088-10ug

10μg sample (liquid)

$99
PB10088-Biotin

100 μg Biotin conjugated

$570
PB10088-Cy3

100 μg Cy3 conjugated

$570
PB10088-Dylight488

100 μg Dylight488 conjugated

$570
PB10088-Dylight550

100 μg Dylight550 conjugated

$570
PB10088-Dylight594

100 μg Dylight594 conjugated

$570
PB10088-FITC

100 μg FITC conjugated

$570
PB10088-HRP

100 μg HRP conjugated

$570
PB10088-APC

100 μg APC conjugated

$670
PB10088-PE

100 μg PE conjugated

$670
PB10088-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB10088
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.