Product Info Summary
SKU: | PB9405 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Rat |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-STAT6 Antibody Picoband™
SKU/Catalog Number
PB9405
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-STAT6 Antibody Picoband™ catalog # PB9405. Tested in WB applications. This antibody reacts with Human, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-STAT6 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9405)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human STAT6, different from the related mouse sequence by three amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB9405 is reactive to STAT6 in Human, Rat
Applications
PB9405 is guaranteed for WB Boster Guarantee
Observed Molecular Weight
94 kDa
Calculated molecular weight
94.135kDa
Background of STAT6
STAT6 is a human gene. The protein encoded by this gene is a member of the STAT family of transcription factors. The gene spans 19 kb and contains 23 exons. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X (L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2), expression of cell surface markers, and class switch of immunoglobulins.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Rat, Human
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of STAT6 using anti-STAT6 antibody (PB9405).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours.
Lane 1: Rat Brain Tissue Lysate at 50ug.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-STAT6 antigen affinity purified polyclonal antibody (Catalog # PB9405) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for STAT6 at approximately 94 kDa. The expected band size for STAT6 is at 94 kDa.
Protein Target Info & Infographic
Gene/Protein Information For STAT6 (Source: Uniprot.org, NCBI)
Gene Name
STAT6
Full Name
Signal transducer and activator of transcription 6
Weight
94.135kDa
Superfamily
transcription factor STAT family
Alternative Names
D12S1644; EC 2.4.1.227; EC 2.7.7.6; IL-4 Stat; IL-4-STAT; signal transducer and activator of transcription 6; signal transducer and activator of transcription 6, interleukin-4 induced; STAT, interleukin-4 induced; STAT, interleukin4-induced; STAT6; STAT6B; STAT6C; transcription factor IL-4 STAT STAT6 D12S1644, IL-4-STATB, STAT6C, STAT6 signal transducer and activator of transcription 6 signal transducer and activator of transcription 6|STAT, interleukin4-induced|signal transducer and activator of transcription 6, interleukin-4 induced|transcription factor IL-4 STAT
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on STAT6, check out the STAT6 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for STAT6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-STAT6 Antibody Picoband™ (PB9405)
Hello CJ!
PB9405 has been cited in 2 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Hydrogen sulfide attenuates myocardial fibrosis in diabetic rats through the JAK/STAT signaling pathway
Li Z, Guan Yq, Liu Jm. Biomaterials. 2014 Jun;35(18):5016-27. Doi: 10.1016/J.Biomaterials.2014.03.004. Epub 2014 Mar 25. The Role Of Stat-6 As A Key Transcription Regulator In Hela Cell Death Induced By Ifn-??/Tnf-?? Co-Immobilized On Nanoparticles.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-STAT6 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Anti-STAT6 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-STAT6 Antibody Picoband™
Question
Would anti-STAT6 antibody PB9405 work for WB with uterus?
Verified Customer
Verified customer
Asked: 2020-04-14
Answer
According to the expression profile of uterus, STAT6 is highly expressed in uterus. So, it is likely that anti-STAT6 antibody PB9405 will work for WB with uterus.
Boster Scientific Support
Answered: 2020-04-14
Question
you antibody using your anti-STAT6 antibody for interleukin-4 and interleukin-13 signaling studies. Has this antibody been tested with western blotting on tissue lysate? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2019-12-12
Answer
We appreciate your inquiry. This PB9405 anti-STAT6 antibody is validated on rat brain tissue, tissue lysate. It is guaranteed to work for WB in human, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2019-12-12
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for uterus using anti-STAT6 antibody PB9405. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-10-29
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-10-29
Question
Is a blocking peptide available for product anti-STAT6 antibody (PB9405)?
Verified Customer
Verified customer
Asked: 2019-09-16
Answer
We do provide the blocking peptide for product anti-STAT6 antibody (PB9405). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-09-16
Question
I see that the anti-STAT6 antibody PB9405 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-09-10
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-09-10
Question
Here is the WB image, lot number and protocol we used for uterus using anti-STAT6 antibody PB9405. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-08-27
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-08-27
Question
My team were content with the WB result of your anti-STAT6 antibody. However we have been able to see positive staining in esophagus cytoplasm. nucleus. note=translocated into using this antibody. Is that expected? Could you tell me where is STAT6 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2019-06-11
Answer
According to literature, esophagus does express STAT6. Generally STAT6 expresses in cytoplasm. nucleus. note=translocated into. Regarding which tissues have STAT6 expression, here are a few articles citing expression in various tissues:
Tongue, Pubmed ID: 14702039
Uterus, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2019-06-11
Question
Will PB9405 anti-STAT6 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-05-22
Answer
You can see on the product datasheet, PB9405 anti-STAT6 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-05-22
Question
Can you help my question with product PB9405, anti-STAT6 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-05-15
Answer
We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9405 anti-STAT6 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-05-15
Question
Is this PB9405 anti-STAT6 antibody reactive to the isotypes of STAT6?
Verified Customer
Verified customer
Asked: 2019-04-08
Answer
The immunogen of PB9405 anti-STAT6 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human STAT6(85-115aa ESIYQRDPLKLVATFRQILQGEKKAVMEQFR), different from the related mouse sequence by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-04-08
Question
I was wanting to use your anti-STAT6 antibody for WB for rat uterus on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat uterus identification?
Verified Customer
Verified customer
Asked: 2018-10-12
Answer
You can see on the product datasheet, PB9405 anti-STAT6 antibody has been validated for WB on human, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat uterus in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2018-10-12
Question
We have been able to see staining in human esophagus. Do you have any suggestions? Is anti-STAT6 antibody supposed to stain esophagus positively?
P. Moore
Verified customer
Asked: 2018-01-04
Answer
According to literature esophagus does express STAT6. According to Uniprot.org, STAT6 is expressed in esophagus, tongue, uterus, among other tissues. Regarding which tissues have STAT6 expression, here are a few articles citing expression in various tissues:
Tongue, Pubmed ID: 14702039
Uterus, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2018-01-04
Question
My lab would like to test anti-STAT6 antibody PB9405 on rat uterus for research purposes, then I may be interested in using anti-STAT6 antibody PB9405 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
E. Singh
Verified customer
Asked: 2017-09-19
Answer
The products we sell, including anti-STAT6 antibody PB9405, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2017-09-19
Question
We are currently using anti-STAT6 antibody PB9405 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, rat. Is it likely that the antibody can work on monkey tissues as well?
E. Wu
Verified customer
Asked: 2016-07-27
Answer
The anti-STAT6 antibody (PB9405) has not been tested for cross reactivity specifically with monkey tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2016-07-27
Question
Is there a BSA free version of anti-STAT6 antibody PB9405 available?
B. Dhar
Verified customer
Asked: 2014-11-18
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-STAT6 antibody PB9405 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2014-11-18