FKBP12 (FKBP1A) (NM_054014) Human Recombinant Protein

FKBP12 protein,

Product Info Summary

SKU: PROTP62942
Size: 20 µg
Source: HEK293T

Product Name

FKBP12 (FKBP1A) (NM_054014) Human Recombinant Protein

View all FKBP12 recombinant proteins

SKU/Catalog Number

PROTP62942

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human FK506 binding protein 1A, 12kDa (FKBP1A), transcript variant 12A

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

FKBP12 (FKBP1A) (NM_054014) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP62942)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

11.951kDa

Amino Acid Sequence

MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For FKBP1A (Source: Uniprot.org, NCBI)

Gene Name

FKBP1A

Full Name

Peptidyl-prolyl cis-trans isomerase FKBP1A

Weight

11.951kDa

Superfamily

FKBP-type PPIase family

Alternative Names

12 kDa FKBP; EC 5.2.1.8; FK506 binding protein 1A, 12kDa; FK506-binding protein 1A; FKBP1; FKBP12; FKBP12C; FKBP12FKBP12-Exip3; FKBP-12T-cell, 12-kD; FKBP1a; FKBP-1A; peptidyl-prolyl cis-trans isomerase FKBP1A; PKC12; PPIase FKBP1A; PPIASE; protein kinase C inhibitor 2; rotamase FKBP1A FKBP-12, FKBP-1A, FKBP1, FKBP12, PKC12, PKCI2, PPIASE FKBP prolyl isomerase 1A peptidyl-prolyl cis-trans isomerase FKBP1A|12 kDa FK506-binding protein|12 kDa FKBP|FK506 binding protein 1A, 12kDa|FK506 binding protein12|FK506-binding protein 1|FK506-binding protein 12|FK506-binding protein 1A|FK506-binding protein, T-cell, 12-kD|FKBP12-Exip3|PPIase FKBP1A|calstabin-1|immunophilin FKBP12|protein kinase C inhibitor 2|rotamase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FKBP1A, check out the FKBP1A Infographic

FKBP1A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FKBP1A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP62942

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FKBP12 (FKBP1A) (NM_054014) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review FKBP12 (FKBP1A) (NM_054014) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FKBP12 (FKBP1A) (NM_054014) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP62942
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.