LIF Leukemia Inhibitory Factor Mouse Recombinant Protein

LIF protein, Mouse

Leukemia Inhibitory Factor (LIF) Murine Recombinant produced in E. coli is a single, non-glycosylated, polypeptide chain containing 181 amino acids and having a molecular mass of 20 kDa. The Leukemia Inhibitory Factor (LIF) is purified by proprietary chromatographic techniques.

Product Info Summary

SKU: PROTP09056
Size: 3x2ug, 25ug, 1mg
Origin Species: Mouse
Source: Escherichia coli

Product Name

LIF Leukemia Inhibitory Factor Mouse Recombinant Protein

View all LIF recombinant proteins

SKU/Catalog Number

PROTP09056

Size

3x2ug, 25ug, 1mg

Description

Leukemia Inhibitory Factor (LIF) Murine Recombinant produced in E. coli is a single, non-glycosylated, polypeptide chain containing 181 amino acids and having a molecular mass of 20 kDa. The Leukemia Inhibitory Factor (LIF) is purified by proprietary chromatographic techniques.

Storage & Handling

Lyophilized Leukemia Inhibitory Factor (LIF) although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Leukemia Inhibitory Factor (LIF) should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Cite This Product

LIF Leukemia Inhibitory Factor Mouse Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP09056)

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Leukemia Inhibitory Factor (LIF) was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM Phosphate buffer pH-7.4 and 0.02% Tween-20.

Purity

Greater than 95.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.

Predicted MW

22.008kDa

Reconstitution

It is recommended to reconstitute the lyophilized Leukemia Inhibitory Factor (LIF) in sterile water not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Amino Acid Sequence

MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFP NNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNP TAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQR KKLGCQLLGTYKQVISVVVQAF

Biological Activity

Activity of murine LIF was determined by the M1 cell differentiation assay which was found to be less than 0.01 ng/ml, corresponding to a specific activity of 100,000,000 IU/mg. A standard of 50 Units is defined as the concentration of mouse LIF in 1.0 mL of tissue culture medium that induces the differentiation of 50% of M1 colonies.

Reconstitution

It is recommended to reconstitute the lyophilized Leukemia Inhibitory Factor (LIF) in sterile water not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Validation Images & Assay Conditions

Gene/Protein Information For LIF (Source: Uniprot.org, NCBI)

Gene Name

LIF

Full Name

Leukemia inhibitory factor

Weight

22.008kDa

Superfamily

LIF/OSM family

Alternative Names

CDF; HILDA; D-FACTOR; Differentiation- stimulating factor; Melanoma-derived LPL inhibitor; MLPLI; Emfilermin; Leukemia inhibitory factor; LIF; DIA LIF CDF, DIA, HILDA, MLPLI LIF interleukin 6 family cytokine leukemia inhibitory factor|D factor|cholinergic differentiation factor|differentiation inhibitory activity|differentiation-inducing factor|differentiation-stimulating factor|hepatocyte-stimulating factor III|human interleukin in DA cells|melanoma-derived LPL inhibitor

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LIF, check out the LIF Infographic

LIF infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LIF: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP09056

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used LIF Leukemia Inhibitory Factor Mouse Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For LIF Leukemia Inhibitory Factor Mouse Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for LIF Leukemia Inhibitory Factor Mouse Recombinant Protein

Size

Total: $250

SKU:PROTP09056

Backordered.

Lead time for this item is typically 10-14 days

Get A Quote
In stock
Order Product
PROTP09056
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.