Product Info Summary
SKU: | PROTP09056 |
---|---|
Size: | 3x2ug, 25ug, 1mg |
Origin Species: | Mouse |
Source: | Escherichia coli |
Customers Who Bought This Also Bought
Product info
Product Name
LIF Leukemia Inhibitory Factor Mouse Recombinant Protein
View all LIF recombinant proteins
SKU/Catalog Number
PROTP09056
Size
3x2ug, 25ug, 1mg
Description
Leukemia Inhibitory Factor (LIF) Murine Recombinant produced in E. coli is a single, non-glycosylated, polypeptide chain containing 181 amino acids and having a molecular mass of 20 kDa. The Leukemia Inhibitory Factor (LIF) is purified by proprietary chromatographic techniques.
Storage & Handling
Lyophilized Leukemia Inhibitory Factor (LIF) although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Leukemia Inhibitory Factor (LIF) should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Cite This Product
LIF Leukemia Inhibitory Factor Mouse Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP09056)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Leukemia Inhibitory Factor (LIF) was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM Phosphate buffer pH-7.4 and 0.02% Tween-20.
Purity
Greater than 95.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Predicted MW
22.008kDa
Reconstitution
It is recommended to reconstitute the lyophilized Leukemia Inhibitory Factor (LIF) in sterile water not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Amino Acid Sequence
MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFP NNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNP TAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQR KKLGCQLLGTYKQVISVVVQAF
Biological Activity
Activity of murine LIF was determined by the M1 cell differentiation assay which was found to be less than 0.01 ng/ml, corresponding to a specific activity of 100,000,000 IU/mg. A standard of 50 Units is defined as the concentration of mouse LIF in 1.0 mL of tissue culture medium that induces the differentiation of 50% of M1 colonies.
Assay dilution & Images
Reconstitution
It is recommended to reconstitute the lyophilized Leukemia Inhibitory Factor (LIF) in sterile water not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For LIF (Source: Uniprot.org, NCBI)
Gene Name
LIF
Full Name
Leukemia inhibitory factor
Weight
22.008kDa
Superfamily
LIF/OSM family
Alternative Names
CDF; HILDA; D-FACTOR; Differentiation- stimulating factor; Melanoma-derived LPL inhibitor; MLPLI; Emfilermin; Leukemia inhibitory factor; LIF; DIA LIF CDF, DIA, HILDA, MLPLI LIF interleukin 6 family cytokine leukemia inhibitory factor|D factor|cholinergic differentiation factor|differentiation inhibitory activity|differentiation-inducing factor|differentiation-stimulating factor|hepatocyte-stimulating factor III|human interleukin in DA cells|melanoma-derived LPL inhibitor
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on LIF, check out the LIF Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for LIF: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For LIF Leukemia Inhibitory Factor Mouse Recombinant Protein (PROTP09056)
Hello CJ!
No publications found for PROTP09056
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used LIF Leukemia Inhibitory Factor Mouse Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For LIF Leukemia Inhibitory Factor Mouse Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question