NRG1 Heregulin-B2 Human Recombinant Protein

Recombinant Human Neuregulin-7.0kDa. NRG-1 is purified by proprietary chromatographic techniques.

Product Info Summary

SKU: PROTQ02297
Size: 10ug, 50ug, 1mg
Origin Species: Mouse
Source: E. Coli
Application: Cell Culture

Product Name

NRG1 Heregulin-B2 Human Recombinant Protein

See all NRG1 products

SKU/Catalog Number

PROTQ02297

Size

10ug, 50ug, 1mg

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Description

Recombinant Human Neuregulin-1 beta 2 produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 61 amino acids and having a total molecular mass of 7.0kDa. NRG-1 is purified by proprietary chromatographic techniques.

Storage & Handling

Lyophilized NRG1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Heregulin should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.

Cite This Product

NRG1 Heregulin-B2 Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ02297)

Predicted MW

70.392kDa

Amino Acid Sequence

SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ.

Biological Activity

The ED50

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For NRG1 (Source: Uniprot.Org, NCBI)

Uniprot ID

Q02297

Gene ID

3084

Gene Name

NRG1

Full Name

Pro-neuregulin-1, membrane-bound isoform

Weight

70.392kDa

Superfamily

neuregulin family

Alternative Names

ARIA; GGF2; GGFglial growth factor; Heregulin-1; HGL; HGLneu differentiation factor; HRG; HRG1; HRG1-alpha; HRG1-beta 1; HRGAneuregulin 1 type IV beta 1a; MST131; MSTP131; NDFheregulin, alpha (45kD, ERBB2 p185-activator); neuregulin 1 type IV beta 3; neuregulin 1; Neuregulin1; Neuregulin-1; NRG1; pro-neuregulin-1, membrane-bound isoform; pro-NRG1; sensory and motor neuron derived factor; SMDF NRG1 ARIA, GGF, GGF2, HGL, HRG, HRG1, HRGA, MST131, MSTP131, NDF-IT2, SMDF, NRG1 neuregulin 1 pro-neuregulin-1, membrane-bound isoform|acetylcholine receptor-inducing activity|glial growth factor 2|heregulin, alpha (45kD, ERBB2 p185-activator)|neu differentiation factor|pro-NRG1|sensory and motor neuron derived factor

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on NRG1, check out the NRG1 Infographic

NRG1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for NRG1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for PROTQ02297

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NRG1 Heregulin-B2 Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review NRG1 Heregulin-B2 Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NRG1 Heregulin-B2 Human Recombinant Protein

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

In stock
Order Product
PROTQ02297
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.