Product Info Summary
SKU: | PB9978 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Ago2/eIF2C2 Antibody Picoband™
SKU/Catalog Number
PB9978
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Ago2/eIF2C2 Antibody Picoband™ catalog # PB9978. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Ago2/eIF2C2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9978)
Host
Rabbit
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Ago2/ eIF2C2, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB9978 is reactive to AGO2 in Human, Mouse, Rat
Applications
PB9978 is guaranteed for WB Boster Guarantee
Observed Molecular Weight
97 kDa
Calculated molecular weight
97.208kDa
Background of AGO2
Protein argonaute-2, also known as AGO2, is a protein that in humans is encoded by the EIF2C2 gene. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of Ago2/eIF2C2 using anti-Ago2/eIF2C2 antibody (PB9978).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human Jurkat whole cell lysates,
Lane 2: human 293T whole cell lysates,
Lane 3: human K562 whole cell lysates,
Lane 4: human MCF-7 whole cell lysates,
Lane 5: rat lung tissue lysates,
Lane 6: rat pancreas tissue lysates,
Lane 7: mouse pancreas tissue lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Ago2/eIF2C2 antigen affinity purified polyclonal antibody (Catalog # PB9978) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Ago2/eIF2C2 at approximately 97 kDa. The expected band size for Ago2/eIF2C2 is at 97 kDa.
Protein Target Info & Infographic
Gene/Protein Information For AGO2 (Source: Uniprot.org, NCBI)
Gene Name
AGO2
Full Name
Protein argonaute-2
Weight
97.208kDa
Superfamily
argonaute family
Alternative Names
Protein argonaute-2 AGO2 CASC7, EIF2C2, LESKRES, LINC00980, PPD, Q10 argonaute RISC catalytic component 2 protein argonaute-2|PAZ Piwi domain protein|argonaute 2, RISC catalytic component|cancer susceptibility candidate 7 (non-protein coding)|eukaryotic translation initiation factor 2C, 2|long intergenic non-protein coding RNA 980|protein slicer
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on AGO2, check out the AGO2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for AGO2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Ago2/eIF2C2 Antibody Picoband™ (PB9978)
Hello CJ!
PB9978 has been cited in 1 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Xin X,Kumar V,Lin F,Kumar V,Bhattarai R,Bhatt VR,Tan C,Mahato RI. Redox-responsive nanoplatform for codelivery of miR-519c and gemcitabine for pancreatic cancer therapy. Sci Adv.2020 Nov 11;6(46):eabd6764.doi:10.1126/sciadv.abd6764.PMID:33177098.
Species: Human
PB9978 usage in article: APP:WB, SAMPLE:PACA-2 CELLS, DILUTION:NA
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Ago2/eIF2C2 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Anti-Ago2/eIF2C2 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-Ago2/eIF2C2 Antibody Picoband™
Question
I have a question about product PB9978, anti-Ago2/eIF2C2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2020-03-12
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9978 anti-Ago2/eIF2C2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2020-03-12
Question
Does anti-Ago2/eIF2C2 antibody PB9978 work for WB with brain eye?
Verified Customer
Verified customer
Asked: 2020-02-27
Answer
According to the expression profile of brain eye, AGO2 is highly expressed in brain eye. So, it is likely that anti-Ago2/eIF2C2 antibody PB9978 will work for WB with brain eye.
Boster Scientific Support
Answered: 2020-02-27
Question
We have observed staining in rat cervix carcinoma erythroleukemia. What should we do? Is anti-Ago2/eIF2C2 antibody supposed to stain cervix carcinoma erythroleukemia positively?
Verified Customer
Verified customer
Asked: 2020-02-27
Answer
Based on literature cervix carcinoma erythroleukemia does express AGO2. Based on Uniprot.org, AGO2 is expressed in forebrain, brain eye, cervix carcinoma erythroleukemia, among other tissues. Regarding which tissues have AGO2 expression, here are a few articles citing expression in various tissues:
Brain, and Eye, Pubmed ID: 15489334
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Boster Scientific Support
Answered: 2020-02-27
Question
I was wanting to use to test anti-Ago2/eIF2C2 antibody PB9978 on mouse brain eye for research purposes, then I may be interested in using anti-Ago2/eIF2C2 antibody PB9978 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-02-21
Answer
The products we sell, including anti-Ago2/eIF2C2 antibody PB9978, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-02-21
Question
I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for brain eye using anti-Ago2/eIF2C2 antibody PB9978. Let me know if you need anything else.
G. Edwards
Verified customer
Asked: 2019-02-08
Answer
I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-02-08
Question
I am looking for using your anti-Ago2/eIF2C2 antibody for positive regulation of angiogenesis studies. Has this antibody been tested with western blotting on mouse brain? We would like to see some validation images before ordering.
M. Miller
Verified customer
Asked: 2019-01-28
Answer
Thanks for your inquiry. This PB9978 anti-Ago2/eIF2C2 antibody is validated on mouse brain, hela whole cell lysates. It is guaranteed to work for WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2019-01-28
Question
Is there a BSA free version of anti-Ago2/eIF2C2 antibody PB9978 available?
J. Thomas
Verified customer
Asked: 2018-11-21
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Ago2/eIF2C2 antibody PB9978 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2018-11-21
Question
Is a blocking peptide available for product anti-Ago2/eIF2C2 antibody (PB9978)?
Verified Customer
Verified customer
Asked: 2018-04-11
Answer
We do provide the blocking peptide for product anti-Ago2/eIF2C2 antibody (PB9978). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2018-04-11
Question
I was wanting to use your anti-Ago2/eIF2C2 antibody for WB for mouse brain eye on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse brain eye identification?
B. Wu
Verified customer
Asked: 2017-12-08
Answer
It shows on the product datasheet, PB9978 anti-Ago2/eIF2C2 antibody has been tested for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse brain eye in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2017-12-08
Question
I see that the anti-Ago2/eIF2C2 antibody PB9978 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2017-06-13
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2017-06-13
Question
Would PB9978 anti-Ago2/eIF2C2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
D. Singh
Verified customer
Asked: 2016-06-15
Answer
It shows on the product datasheet, PB9978 anti-Ago2/eIF2C2 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2016-06-15
Question
We are currently using anti-Ago2/eIF2C2 antibody PB9978 for rat tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on dog tissues as well?
T. Jones
Verified customer
Asked: 2015-09-04
Answer
The anti-Ago2/eIF2C2 antibody (PB9978) has not been tested for cross reactivity specifically with dog tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2015-09-04
Question
Is this PB9978 anti-Ago2/eIF2C2 antibody reactive to the isotypes of AGO2?
F. Jackson
Verified customer
Asked: 2014-12-22
Answer
The immunogen of PB9978 anti-Ago2/eIF2C2 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Ago2/ eIF2C2 (129-169aa KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL), identical to the related mouse and rat sequences. . Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2014-12-22
Question
See attached the WB image, lot number and protocol we used for brain eye using anti-Ago2/eIF2C2 antibody PB9978. Please let me know if you require anything else.
L. Patel
Verified customer
Asked: 2014-07-30
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2014-07-30
Question
My colleagues were well pleased with the WB result of your anti-Ago2/eIF2C2 antibody. However we have seen positive staining in cervix carcinoma erythroleukemia cytoplasm using this antibody. Is that expected? Could you tell me where is AGO2 supposed to be expressed?
J. Jones
Verified customer
Asked: 2013-07-16
Answer
From what I have seen in literature, cervix carcinoma erythroleukemia does express AGO2. Generally AGO2 expresses in cytoplasm, p-body. Regarding which tissues have AGO2 expression, here are a few articles citing expression in various tissues:
Brain, and Eye, Pubmed ID: 15489334
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Boster Scientific Support
Answered: 2013-07-16