Anti-ATG14L Antibody Picoband™

ATG14 antibody

Boster Bio Anti-ATG14L Antibody Picoband™ catalog # PB9481. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Rat. Cited in 1 publication(s).

Product Info Summary

SKU: PB9481
Size: 100 μg/vial
Reactive Species: Human, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC, ICC, WB

Product Name

Anti-ATG14L Antibody Picoband™

View all ATG14 Antibodies

SKU/Catalog Number

PB9481

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-ATG14L Antibody Picoband™ catalog # PB9481. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-ATG14L Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9481)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human ATG14L, different from the related mouse and rat sequences by two amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9481 is reactive to ATG14 in Human, Rat

Applications

PB9481 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee

Observed Molecular Weight

59 kDa

Calculated molecular weight

55.309kDa

Background of ATG14

ATG14 (also known as beclin-1-associated autophagy-related key regulator (Barkor) or ATG14L), an essential autophagy-specific regulator of the class III phosphatidylinositol 3-kinase complex, promotes membrane tethering of protein-free liposomes, and enhances hemifusion and full fusion of proteoliposomes reconstituted with the target (t)-SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) syntaxin 17 (STX17) and SNAP29, and the vesicle (v)-SNARE VAMP8 (vesicle-associated membrane protein 8). ATG14 binds to the SNARE core domain of STX17 through its coiled-coil domain, and stabilizes the STX17-SNAP29 binary t-SNARE complex on autophagosomes.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Rat, By Heat
Immunocytochemistry/Immunofluorescence, 5 μg/ml, Human
Immunofluorescence, 5 μg/ml, Human, Rat
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For ATG14 (Source: Uniprot.org, NCBI)

Gene Name

ATG14

Full Name

Beclin 1-associated autophagy-related key regulator

Weight

55.309kDa

Superfamily

ATG14 family

Alternative Names

ATG14 Autophagy Related 14 Homolog (S. Cerevisiae); ATG14 Autophagy Related 14 Homolog; ATG14L; Autophagy Related 14; Autophagy-Related Protein 14-Like Protein; Barkor; Beclin 1-Associated Autophagy-Related Key Regulator; Beclin 1-interacting protein; KIAA0831 ATG14 ATG14L, BARKOR, KIAA0831 autophagy related 14 beclin 1-associated autophagy-related key regulator|ATG14 autophagy related 14 homolog|Beclin 1-Interacting protein|autophagy-related protein 14-like protein

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on ATG14, check out the ATG14 Infographic

ATG14 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ATG14: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

PB9481 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Polydatin induces apoptosis and autophagy via STAT3 signaling in human osteosarcoma MG-63 cells

Have you used Anti-ATG14L Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-ATG14L Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

17 Customer Q&As for Anti-ATG14L Antibody Picoband™

Question

My lab would like to test anti-ATG14L?Picoband™ antibody PB9481 on human female gonad for research purposes, then I may be interested in using anti-ATG14L?Picoband™ antibody PB9481 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2020-04-27

Answer

The products we sell, including anti-ATG14L?Picoband™ antibody PB9481, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2020-04-27

Question

Would anti-ATG14L?Picoband™ antibody PB9481 work on dog Flow Cytometry with cervix carcinoma?

Verified Customer

Verified customer

Asked: 2020-04-24

Answer

Our lab technicians have not validated anti-ATG14L?Picoband™ antibody PB9481 on dog. You can run a BLAST between dog and the immunogen sequence of anti-ATG14L?Picoband™ antibody PB9481 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated dog samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in dog cervix carcinoma in Flow Cytometry, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-04-24

Question

I was wanting to use your anti-ATG14L?Picoband™ antibody for ICC for human female gonad on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human female gonad identification?

Verified Customer

Verified customer

Asked: 2020-02-14

Answer

As indicated on the product datasheet, PB9481 anti-ATG14L?Picoband™ antibody has been tested for Flow Cytometry, IHC, ICC, WB on human, rat tissues. We have an innovator award program that if you test this antibody and show it works in human female gonad in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-02-14

Question

Is a blocking peptide available for product anti-ATG14L?Picoband™ antibody (PB9481)?

Verified Customer

Verified customer

Asked: 2019-11-29

Answer

We do provide the blocking peptide for product anti-ATG14L?Picoband™ antibody (PB9481). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-11-29

Question

We are currently using anti-ATG14L?Picoband™ antibody PB9481 for rat tissue, and we are well pleased with the ICC results. The species of reactivity given in the datasheet says human, rat. Is it possible that the antibody can work on bovine tissues as well?

Verified Customer

Verified customer

Asked: 2019-10-14

Answer

The anti-ATG14L?Picoband™ antibody (PB9481) has not been tested for cross reactivity specifically with bovine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-10-14

Question

We want using your anti-ATG14L?antibody for cellular response to starvation studies. Has this antibody been tested with western blotting on siha cells? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2019-06-17

Answer

We appreciate your inquiry. This PB9481 anti-ATG14L?antibody is validated on rat spleen tissue, brain tissue, tissue lysate, hela whole cell lysate, lung cancer tissue, siha cells, a431 cells. It is guaranteed to work for Flow Cytometry, IHC, ICC, WB in human, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2019-06-17

Question

Please see the WB image, lot number and protocol we used for female gonad using anti-ATG14L?Picoband™ antibody PB9481. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-05-09

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-05-09

Question

My team were well pleased with the WB result of your anti-ATG14L?Picoband™ antibody. However we have seen positive staining in hippocampus trachea cytoplasm. using this antibody. Is that expected? Could you tell me where is ATG14 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-02-28

Answer

From what I have seen in literature, hippocampus trachea does express ATG14. Generally ATG14 expresses in cytoplasm. Regarding which tissues have ATG14 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 10048485
Cervix carcinoma, Pubmed ID: 17081983
Hippocampus, and Trachea, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2019-02-28

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for female gonad using anti-ATG14L?Picoband™ antibody PB9481. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2018-05-28

Answer

I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-05-28

Question

We have observed staining in rat brain. What should we do? Is anti-ATG14L?Picoband™ antibody supposed to stain brain positively?

Verified Customer

Verified customer

Asked: 2018-04-09

Answer

Based on literature brain does express ATG14. Based on Uniprot.org, ATG14 is expressed in female gonad, brain, hippocampus trachea, cervix carcinoma, among other tissues. Regarding which tissues have ATG14 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 10048485
Cervix carcinoma, Pubmed ID: 17081983
Hippocampus, and Trachea, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2018-04-09

Question

I see that the anti-ATG14L?Picoband™ antibody PB9481 works with ICC, what is the protocol used to produce the result images on the product page?

J. Johnson

Verified customer

Asked: 2017-12-14

Answer

You can find protocols for ICC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2017-12-14

Question

Would PB9481 anti-ATG14L?Picoband™ antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2017-11-16

Answer

As indicated on the product datasheet, PB9481 anti-ATG14L?Picoband™ antibody as been tested on ICC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2017-11-16

Question

Our lab used your anti-ATG14L?Picoband™ antibody for Flow Cytometry on hippocampus trachea last year. I am using rat, and We want to use the antibody for IHC next. I am interested in examining hippocampus trachea as well as brain in our next experiment. Could give a recommendation on which antibody would work the best for IHC?

J. Parker

Verified customer

Asked: 2016-03-21

Answer

I looked at the website and datasheets of our anti-ATG14L?Picoband™ antibody and it appears that PB9481 has been tested on rat in both Flow Cytometry and IHC. Thus PB9481 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2016-03-21

Question

I have a question about product PB9481, anti-ATG14L?Picoband™ antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

C. Evans

Verified customer

Asked: 2015-08-24

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9481 anti-ATG14L?Picoband™ antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2015-08-24

Question

Does anti-ATG14L?Picoband™ antibody PB9481 work for ICC with female gonad?

B. Parker

Verified customer

Asked: 2014-01-24

Answer

According to the expression profile of female gonad, ATG14 is highly expressed in female gonad. So, it is likely that anti-ATG14L?Picoband™ antibody PB9481 will work for ICC with female gonad.

Boster Scientific Support

Answered: 2014-01-24

Question

Do you have a BSA free version of anti-ATG14L?Picoband™ antibody PB9481 available?

B. Gonzalez

Verified customer

Asked: 2013-12-03

Answer

I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-ATG14L?Picoband™ antibody PB9481 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2013-12-03

Question

Is this PB9481 anti-ATG14L?Picoband™ antibody reactive to the isotypes of ATG14?

A. Jones

Verified customer

Asked: 2013-05-30

Answer

The immunogen of PB9481 anti-ATG14L?Picoband™ antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human ATG14L (70-101aa RDRERFIDKKERLSRLKSKQEEFQKEVLKAME), different from the related mouse and rat sequences by two amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2013-05-30

Order DetailsPrice
PB9481

100μg

$370
PB9481-10ug

10μg sample (liquid)

$99
PB9481-Biotin

100 μg Biotin conjugated

$570
PB9481-Cy3

100 μg Cy3 conjugated

$570
PB9481-Dylight488

100 μg Dylight488 conjugated

$570
PB9481-Dylight550

100 μg Dylight550 conjugated

$570
PB9481-Dylight594

100 μg Dylight594 conjugated

$570
PB9481-FITC

100 μg FITC conjugated

$570
PB9481-HRP

100 μg HRP conjugated

$570
PB9481-APC

100 μg APC conjugated

$670
PB9481-PE

100 μg PE conjugated

$670
PB9481-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9481
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.