Anti-BMP2 Antibody Picoband™

BMP2 antibody

Boster Bio Anti-BMP2 Antibody Picoband™ catalog # PB9687. Tested in ELISA, IHC, WB applications. This antibody reacts with Human, Rat. Cited in 34 publication(s).

Product Info Summary

SKU: PB9687
Size: 100 μg/vial
Reactive Species: Human, Rat
Host: Rabbit
Application: ELISA, IHC, WB

Product Name

Anti-BMP2 Antibody Picoband™

View all BMP2 Antibodies

SKU/Catalog Number

PB9687

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-BMP2 Antibody Picoband™ catalog # PB9687. Tested in ELISA, IHC, WB applications. This antibody reacts with Human, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-BMP2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9687)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-2, identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9687 is reactive to BMP2 in Human, Rat

Applications

PB9687 is guaranteed for ELISA, IHC, WB Boster Guarantee

Observed Molecular Weight

20 kDa, 40 kDa

Calculated molecular weight

44.702kDa

Background of BMP2

BMP2 is also known as Bone morphogenetic protein 2 or BMP2A. It is mapped to 20p12. The protein encoded by this gene belongs to the transforming growth factor-beta (TGFB) superfamily. BMP-2, like other bone morphogenetic proteins, plays an important role in the development of bone and cartilage. It is involved in the hedgehog pathway, TGF beta signaling pathway, and in cytokine-cytokine receptor interaction. Also, it is involved in cardiac cell differentiation and epithelial to mesenchymal transition. In addition, BMP2A has been suggested as a reasonable candidate for the human condition fibrodysplasia (myositis) ossificans progressiva, on the basis of observations in a Drosophila model.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
ELISA(Cap) , 1-5μg/ml, Human, -

Validation Images & Assay Conditions

Gene/Protein Information For BMP2 (Source: Uniprot.org, NCBI)

Gene Name

BMP2

Full Name

Bone morphogenetic protein 2

Weight

44.702kDa

Superfamily

TGF-beta family

Alternative Names

BDA2; BMP2; BMP-2; BMP-2A; BMP2ABone morphogenetic protein 2A; bone morphogenetic protein 2; SSFSC BMP2 BDA2A, SSFSC, SSFSC1, BMP2 bone morphogenetic protein 2 bone morphogenetic protein 2|bone morphogenetic protein 2A

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on BMP2, check out the BMP2 Infographic

BMP2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for BMP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

PB9687 has been cited in 34 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Bone morphogenetic protein-2: a potential regulator in scleral remodeling

Construction and expression of a bicistronic vector containing human bone morphogenetic protein 2 and vascular endothelial growth factor-165 genesin vitro

Involvement of parathyroid hormone‐related protein in vascular calcification of chronic haemodialysis patients

An improved osseointegration of metal implants by pitavastatin loaded multilayer films with osteogenic and angiogenic properties

Construction of chemokine substance P-embedded biomimetic multilayer onto bioactive magnesium silicate-titanium implant for bone regeneration

Untangling the response of bone tumor cells and bone forming cells to matrix stiffness and adhesion ligand density by means of hydrogels
Species: Human

Surface modification of titanium implants by ZIF-8@Levo/LBL coating for inhibition of bacterial-associated infection and enhancement of in vivo osseointegration
Species: Rat

Zhurong Tang,Siyu Chen,Yilu Ni,Rui Zhao,Xiangdong Zhu,Xiao Yang,Xingdong Zhang,Role of Na+, K+-ATPase ion pump in osteoinduction,Acta Biomaterialia,2021,,ISSN 1742-7061,https://doi.org/10.1016/j.actbio.2021.05.026.
Species: Mouse
PB9687 usage in article: APP:IHC, SAMPLE:CERAMIC IMPLANTS, DILUTION:NA

Caiyun Mu,Ye He,Yan Hu,Menghuan Li,Maowen Chen,Rong Wang,Yang Xiang, Zhong Luo,Kaiyong Cai,Construction of chemokine substance P-embedded biomimetic multilayer onto bioactive magnesium silicate-titanium implant for bone regeneration,Applied Materials Toda
Species: Mouse,Rat
PB9687 usage in article: APP:WB, SAMPLE:MSCS, DILUTION:NA

Chen G,Wang Q,Li Z,Yang Q,Liu Y,Du Z,Zhang G,Song Y.Circular RNA CDR1as promotes adipogenic and suppresses osteogenic differentiation of BMSCs in steroid-induced osteonecrosis of the femoral head.Bone.2020 Apr;133:115258.doi:10.1016/j.bone.2020.115258.Epu
Species: Human
PB9687 usage in article: APP:WB, SAMPLE:BMSCS, DILUTION:NA

Have you used Anti-BMP2 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-BMP2 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

13 Customer Q&As for Anti-BMP2 Antibody Picoband™

Question

I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for thyroid gland using anti-BMP2 antibody PB9687. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2020-02-27

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-02-27

Question

Can you help my question with product PB9687, anti-BMP2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-12-17

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9687 anti-BMP2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-12-17

Question

Do you have a BSA free version of anti-BMP2 antibody PB9687 available?

Verified Customer

Verified customer

Asked: 2019-11-28

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-BMP2 antibody PB9687 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-11-28

Question

Is this PB9687 anti-BMP2 antibody reactive to the isotypes of BMP2?

Verified Customer

Verified customer

Asked: 2019-10-24

Answer

The immunogen of PB9687 anti-BMP2 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-2 (283-312aa QAKHKQRKRLKSSCKRHPLYVDFSDVGWND), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-10-24

Question

I was wanting to use your anti-BMP2 antibody for ELISA for human thyroid gland on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human thyroid gland identification?

Verified Customer

Verified customer

Asked: 2019-09-06

Answer

It shows on the product datasheet, PB9687 anti-BMP2 antibody has been tested for ELISA, IHC, WB on human, rat tissues. We have an innovator award program that if you test this antibody and show it works in human thyroid gland in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-09-06

Question

Will anti-BMP2 antibody PB9687 work for ELISA with thyroid gland?

Verified Customer

Verified customer

Asked: 2019-01-07

Answer

According to the expression profile of thyroid gland, BMP2 is highly expressed in thyroid gland. So, it is likely that anti-BMP2 antibody PB9687 will work for ELISA with thyroid gland.

Boster Scientific Support

Answered: 2019-01-07

Question

I am looking for using your anti-BMP2 antibody for transcriptional regulation by runx2 studies. Has this antibody been tested with western blotting on rat lung tissue? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2019-01-01

Answer

We appreciate your inquiry. This PB9687 anti-BMP2 antibody is validated on rat lung tissue, tissue lysate, brain tissue, u87 whole cell lysate, hela whole cell lysate, intestinal cancer tissue. It is guaranteed to work for ELISA, IHC, WB in human, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2019-01-01

Question

See attached the WB image, lot number and protocol we used for thyroid gland using anti-BMP2 antibody PB9687. Please let me know if you require anything else.

Z. Krishna

Verified customer

Asked: 2018-03-06

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-03-06

Question

I see that the anti-BMP2 antibody PB9687 works with ELISA, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2017-09-27

Answer

You can find protocols for ELISA on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2017-09-27

Question

Will PB9687 anti-BMP2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2017-09-06

Answer

You can see on the product datasheet, PB9687 anti-BMP2 antibody as been validated on ELISA. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2017-09-06

Question

We are interested in to test anti-BMP2 antibody PB9687 on human thyroid gland for research purposes, then I may be interested in using anti-BMP2 antibody PB9687 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

L. Mangal

Verified customer

Asked: 2017-03-29

Answer

The products we sell, including anti-BMP2 antibody PB9687, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2017-03-29

Question

Is a blocking peptide available for product anti-BMP2 antibody (PB9687)?

K. Taylor

Verified customer

Asked: 2015-01-26

Answer

We do provide the blocking peptide for product anti-BMP2 antibody (PB9687). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2015-01-26

Question

We are currently using anti-BMP2 antibody PB9687 for human tissue, and we are well pleased with the ELISA results. The species of reactivity given in the datasheet says human, rat. Is it possible that the antibody can work on horse tissues as well?

A. Krishna

Verified customer

Asked: 2014-11-26

Answer

The anti-BMP2 antibody (PB9687) has not been validated for cross reactivity specifically with horse tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2014-11-26

Order DetailsPrice
PB9687

100μg

$370
PB9687-10ug

10μg sample (liquid)

$99
PB9687-Biotin

100 μg Biotin conjugated

$570
PB9687-Cy3

100 μg Cy3 conjugated

$570
PB9687-Dylight488

100 μg Dylight488 conjugated

$570
PB9687-Dylight550

100 μg Dylight550 conjugated

$570
PB9687-Dylight594

100 μg Dylight594 conjugated

$570
PB9687-FITC

100 μg FITC conjugated

$570
PB9687-HRP

100 μg HRP conjugated

$570
PB9687-APC

100 μg APC conjugated

$670
PB9687-PE

100 μg PE conjugated

$670
PB9687-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9687
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.