Product Info Summary
SKU: | A01394 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human |
Host: | Rabbit |
Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Iba1/AIF1 Antibody Picoband™
View all AIF-1/Iba1 Antibodies
SKU/Catalog Number
A01394
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Iba1/AIF1 Antibody Picoband™ catalog # A01394. Tested in IHC, WB applications. This antibody reacts with Human.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Iba1/AIF1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01394)
Host
Rabbit
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Iba1, different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
A01394 is reactive to AIF1 in Human
Applications
A01394 is guaranteed for IHC, WB Boster Guarantee
Observed Molecular Weight
17 kDa
Calculated molecular weight
16.703kDa
Background of AIF-1/Iba1
Allograft inflammatory factor 1 (AIF-1), also known as ionized calcium-binding adapter molecule 1 (IBA1), is a protein that in humans is encoded by the AIF1 gene. This gene encodes a protein that binds actin and calcium. And this gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, By Heat
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of Iba1/AIF1 using anti-Iba1/AIF1 antibody (A01394).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human HEL whole cell lysates,
Lane 2: human THP-1 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Iba1/AIF1 antigen affinity purified polyclonal antibody (Catalog # A01394) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Iba1/AIF1 at approximately 17 kDa. The expected band size for Iba1/AIF1 is at 17 kDa.
Click image to see more details
Figure 2. IHC analysis of Iba1/AIF1 using anti-Iba1/AIF1 antibody (A01394).
Iba1/AIF1 was detected in a paraffin-embedded section of human spleen tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-Iba1/AIF1 Antibody (A01394) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For AIF1 (Source: Uniprot.org, NCBI)
Gene Name
AIF1
Full Name
Allograft inflammatory factor 1
Weight
16.703kDa
Alternative Names
AIF1; AIF-1; AIF-1IRT1; allograft inflammatory factor 1; G1; IBA1; IBA1Em:AF129756.17; IbaI; interferon gamma responsive transcript; Ionized calcium-binding adapter molecule 1; IRT1; IRT-1; Protein G1 AIF1 AIF-1, IBA1, IRT-1, IRT1 allograft inflammatory factor 1 allograft inflammatory factor 1|interferon gamma responsive transcript|ionized calcium-binding adapter molecule 1|protein G1
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on AIF1, check out the AIF1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for AIF1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Iba1/AIF1 Antibody Picoband™ (A01394)
Hello CJ!
A01394 has been cited in 6 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Pathway of programmed cell death in HeLa cells induced by polymeric anti-cancer drugs
Species: Human
The Novel Dual GLP-1/GIP Receptor Agonist DA-CH5 Is Superior to Single GLP-1 Receptor Agonists in the MPTP Model of Parkinson's Disease Lingyu Zhang J Parkinson's Dis. 2020;10(2):523-542. DOI: 10.3233/JPD-191768.
Wnt5a Increases Properties of Lung Cancer Stem Cells and Resistance to Cisplatin through Activation of Wnt5a/PKC Signaling Pathway
Alkaloids from piper longum protect dopaminergic neurons against inflammation-mediated damage induced by intranigral injection of lipopolysaccharide
Mechanism of apoptosis induction in human hepatocellular carcinoma cells following treatment with a gecko peptides mixture
Re-infection of the prion from the scrapie?infected cell line SMB-S15 in three strains of mice, CD1, C57BL/6 and Balb/c
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Iba1/AIF1 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Anti-Iba1/AIF1 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-Iba1/AIF1 Antibody Picoband™
Question
Our team were satisfied with the WB result of your anti-Iba1/AIF1 antibody. However we have seen positive staining in lymphocyte cytoskeleton using this antibody. Is that expected? Could you tell me where is AIF1 supposed to be expressed?
A. Moore
Verified customer
Asked: 2020-04-16
Answer
According to literature, lymphocyte does express AIF1. Generally AIF1 expresses in cytoplasm, cytoskeleton. Regarding which tissues have AIF1 expression, here are a few articles citing expression in various tissues:
Erythroleukemia, Pubmed ID: 23186163
Glial tumor, Pubmed ID: 14702039
Liver, Pubmed ID: 24275569
Lymphocyte, Pubmed ID: 8912632
Prostate, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2020-04-16
Question
I have a question about product A01394, anti-Iba1/AIF1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2020-04-09
Answer
We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01394 anti-Iba1/AIF1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2020-04-09
Question
Does A01394 anti-Iba1/AIF1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2020-03-12
Answer
It shows on the product datasheet, A01394 anti-Iba1/AIF1 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-03-12
Question
Is this A01394 anti-Iba1/AIF1 antibody reactive to the isotypes of AIF1?
Verified Customer
Verified customer
Asked: 2020-02-26
Answer
The immunogen of A01394 anti-Iba1/AIF1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human Iba1 (99-133aa ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-02-26
Question
We are currently using anti-Iba1/AIF1 antibody A01394 for human tissue, and we are satisfied with the IHC results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on zebrafish tissues as well?
Verified Customer
Verified customer
Asked: 2020-02-07
Answer
The anti-Iba1/AIF1 antibody (A01394) has not been validated for cross reactivity specifically with zebrafish tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-02-07
Question
Do you have a BSA free version of anti-Iba1/AIF1 antibody A01394 available?
Verified Customer
Verified customer
Asked: 2020-01-13
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Iba1/AIF1 antibody A01394 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-01-13
Question
Our lab used your anti-Iba1/AIF1 antibody for IHC on glial tumor a few years ago. I am using human, and We want to use the antibody for WB next. I would like examining glial tumor as well as erythroleukemia in our next experiment. Could you please give me some suggestion on which antibody would work the best for WB?
Verified Customer
Verified customer
Asked: 2019-10-07
Answer
I looked at the website and datasheets of our anti-Iba1/AIF1 antibody and I see that A01394 has been validated on human in both IHC and WB. Thus A01394 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2019-10-07
Question
Does anti-Iba1/AIF1 antibody A01394 work for WB with prostate?
Verified Customer
Verified customer
Asked: 2019-09-17
Answer
According to the expression profile of prostate, AIF1 is highly expressed in prostate. So, it is likely that anti-Iba1/AIF1 antibody A01394 will work for WB with prostate.
Boster Scientific Support
Answered: 2019-09-17
Question
I have attached the WB image, lot number and protocol we used for prostate using anti-Iba1/AIF1 antibody A01394. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-08-19
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-08-19
Question
I would like to test anti-Iba1/AIF1 antibody A01394 on human prostate for research purposes, then I may be interested in using anti-Iba1/AIF1 antibody A01394 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-07-10
Answer
The products we sell, including anti-Iba1/AIF1 antibody A01394, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-07-10
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for prostate using anti-Iba1/AIF1 antibody A01394. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-06-24
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-06-24
Question
Is a blocking peptide available for product anti-Iba1/AIF1 antibody (A01394)?
Verified Customer
Verified customer
Asked: 2019-06-04
Answer
We do provide the blocking peptide for product anti-Iba1/AIF1 antibody (A01394). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-06-04
Question
I was wanting to use your anti-Iba1/AIF1 antibody for WB for human prostate on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human prostate identification?
R. Wu
Verified customer
Asked: 2017-09-20
Answer
You can see on the product datasheet, A01394 anti-Iba1/AIF1 antibody has been tested for IHC, WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human prostate in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2017-09-20
Question
I see that the anti-Iba1/AIF1 antibody A01394 works with WB, what is the protocol used to produce the result images on the product page?
V. Krishna
Verified customer
Asked: 2017-06-14
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2017-06-14
Question
We have seen staining in human prostate. Any tips? Is anti-Iba1/AIF1 antibody supposed to stain prostate positively?
F. Anderson
Verified customer
Asked: 2014-07-28
Answer
Based on literature prostate does express AIF1. Based on Uniprot.org, AIF1 is expressed in metanephric glomerulus, lymphocyte, glial tumor, prostate, erythroleukemia, liver, among other tissues. Regarding which tissues have AIF1 expression, here are a few articles citing expression in various tissues:
Erythroleukemia, Pubmed ID: 23186163
Glial tumor, Pubmed ID: 14702039
Liver, Pubmed ID: 24275569
Lymphocyte, Pubmed ID: 8912632
Prostate, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2014-07-28