Anti-Iba1/AIF1 Antibody Picoband™

AIF-1/Iba1 antibody

Boster Bio Anti-Iba1/AIF1 Antibody Picoband™ catalog # A01394. Tested in IHC, WB applications. This antibody reacts with Human. Cited in 6 publication(s).

Product Info Summary

SKU: A01394
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: IHC, WB

Product Name

Anti-Iba1/AIF1 Antibody Picoband™

View all AIF-1/Iba1 Antibodies

SKU/Catalog Number

A01394

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Iba1/AIF1 Antibody Picoband™ catalog # A01394. Tested in IHC, WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Iba1/AIF1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01394)

Host

Rabbit

Contents

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human Iba1, different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

A01394 is reactive to AIF1 in Human

Applications

A01394 is guaranteed for IHC, WB Boster Guarantee

Observed Molecular Weight

17 kDa

Calculated molecular weight

16.703kDa

Background of AIF-1/Iba1

Allograft inflammatory factor 1 (AIF-1), also known as ionized calcium-binding adapter molecule 1 (IBA1), is a protein that in humans is encoded by the AIF1 gene. This gene encodes a protein that binds actin and calcium. And this gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human
Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, By Heat

Validation Images & Assay Conditions

Gene/Protein Information For AIF1 (Source: Uniprot.org, NCBI)

Gene Name

AIF1

Full Name

Allograft inflammatory factor 1

Weight

16.703kDa

Alternative Names

AIF1; AIF-1; AIF-1IRT1; allograft inflammatory factor 1; G1; IBA1; IBA1Em:AF129756.17; IbaI; interferon gamma responsive transcript; Ionized calcium-binding adapter molecule 1; IRT1; IRT-1; Protein G1 AIF1 AIF-1, IBA1, IRT-1, IRT1 allograft inflammatory factor 1 allograft inflammatory factor 1|interferon gamma responsive transcript|ionized calcium-binding adapter molecule 1|protein G1

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on AIF1, check out the AIF1 Infographic

AIF1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for AIF1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

A01394 has been cited in 6 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Pathway of programmed cell death in HeLa cells induced by polymeric anti-cancer drugs
Species: Human

The Novel Dual GLP-1/GIP Receptor Agonist DA-CH5 Is Superior to Single GLP-1 Receptor Agonists in the MPTP Model of Parkinson's Disease Lingyu Zhang J Parkinson's Dis. 2020;10(2):523-542. DOI: 10.3233/JPD-191768.

Wnt5a Increases Properties of Lung Cancer Stem Cells and Resistance to Cisplatin through Activation of Wnt5a/PKC Signaling Pathway

Alkaloids from piper longum protect dopaminergic neurons against inflammation-mediated damage induced by intranigral injection of lipopolysaccharide

Mechanism of apoptosis induction in human hepatocellular carcinoma cells following treatment with a gecko peptides mixture

Re-infection of the prion from the scrapie?infected cell line SMB-S15 in three strains of mice, CD1, C57BL/6 and Balb/c

Have you used Anti-Iba1/AIF1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-Iba1/AIF1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

15 Customer Q&As for Anti-Iba1/AIF1 Antibody Picoband™

Question

Our team were satisfied with the WB result of your anti-Iba1/AIF1 antibody. However we have seen positive staining in lymphocyte cytoskeleton using this antibody. Is that expected? Could you tell me where is AIF1 supposed to be expressed?

A. Moore

Verified customer

Asked: 2020-04-16

Answer

According to literature, lymphocyte does express AIF1. Generally AIF1 expresses in cytoplasm, cytoskeleton. Regarding which tissues have AIF1 expression, here are a few articles citing expression in various tissues:
Erythroleukemia, Pubmed ID: 23186163
Glial tumor, Pubmed ID: 14702039
Liver, Pubmed ID: 24275569
Lymphocyte, Pubmed ID: 8912632
Prostate, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2020-04-16

Question

I have a question about product A01394, anti-Iba1/AIF1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2020-04-09

Answer

We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01394 anti-Iba1/AIF1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2020-04-09

Question

Does A01394 anti-Iba1/AIF1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2020-03-12

Answer

It shows on the product datasheet, A01394 anti-Iba1/AIF1 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2020-03-12

Question

Is this A01394 anti-Iba1/AIF1 antibody reactive to the isotypes of AIF1?

Verified Customer

Verified customer

Asked: 2020-02-26

Answer

The immunogen of A01394 anti-Iba1/AIF1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human Iba1 (99-133aa ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-02-26

Question

We are currently using anti-Iba1/AIF1 antibody A01394 for human tissue, and we are satisfied with the IHC results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on zebrafish tissues as well?

Verified Customer

Verified customer

Asked: 2020-02-07

Answer

The anti-Iba1/AIF1 antibody (A01394) has not been validated for cross reactivity specifically with zebrafish tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-02-07

Question

Do you have a BSA free version of anti-Iba1/AIF1 antibody A01394 available?

Verified Customer

Verified customer

Asked: 2020-01-13

Answer

I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Iba1/AIF1 antibody A01394 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-01-13

Question

Our lab used your anti-Iba1/AIF1 antibody for IHC on glial tumor a few years ago. I am using human, and We want to use the antibody for WB next. I would like examining glial tumor as well as erythroleukemia in our next experiment. Could you please give me some suggestion on which antibody would work the best for WB?

Verified Customer

Verified customer

Asked: 2019-10-07

Answer

I looked at the website and datasheets of our anti-Iba1/AIF1 antibody and I see that A01394 has been validated on human in both IHC and WB. Thus A01394 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2019-10-07

Question

Does anti-Iba1/AIF1 antibody A01394 work for WB with prostate?

Verified Customer

Verified customer

Asked: 2019-09-17

Answer

According to the expression profile of prostate, AIF1 is highly expressed in prostate. So, it is likely that anti-Iba1/AIF1 antibody A01394 will work for WB with prostate.

Boster Scientific Support

Answered: 2019-09-17

Question

I have attached the WB image, lot number and protocol we used for prostate using anti-Iba1/AIF1 antibody A01394. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-08-19

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-08-19

Question

I would like to test anti-Iba1/AIF1 antibody A01394 on human prostate for research purposes, then I may be interested in using anti-Iba1/AIF1 antibody A01394 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-07-10

Answer

The products we sell, including anti-Iba1/AIF1 antibody A01394, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-07-10

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for prostate using anti-Iba1/AIF1 antibody A01394. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-06-24

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-06-24

Question

Is a blocking peptide available for product anti-Iba1/AIF1 antibody (A01394)?

Verified Customer

Verified customer

Asked: 2019-06-04

Answer

We do provide the blocking peptide for product anti-Iba1/AIF1 antibody (A01394). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-06-04

Question

I was wanting to use your anti-Iba1/AIF1 antibody for WB for human prostate on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human prostate identification?

R. Wu

Verified customer

Asked: 2017-09-20

Answer

You can see on the product datasheet, A01394 anti-Iba1/AIF1 antibody has been tested for IHC, WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human prostate in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-09-20

Question

I see that the anti-Iba1/AIF1 antibody A01394 works with WB, what is the protocol used to produce the result images on the product page?

V. Krishna

Verified customer

Asked: 2017-06-14

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2017-06-14

Question

We have seen staining in human prostate. Any tips? Is anti-Iba1/AIF1 antibody supposed to stain prostate positively?

F. Anderson

Verified customer

Asked: 2014-07-28

Answer

Based on literature prostate does express AIF1. Based on Uniprot.org, AIF1 is expressed in metanephric glomerulus, lymphocyte, glial tumor, prostate, erythroleukemia, liver, among other tissues. Regarding which tissues have AIF1 expression, here are a few articles citing expression in various tissues:
Erythroleukemia, Pubmed ID: 23186163
Glial tumor, Pubmed ID: 14702039
Liver, Pubmed ID: 24275569
Lymphocyte, Pubmed ID: 8912632
Prostate, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2014-07-28

Order DetailsPrice
A01394

100μg

$370
A01394-10ug

10μg sample (liquid)

$99
A01394-Biotin

100 μg Biotin conjugated

$570
A01394-Cy3

100 μg Cy3 conjugated

$570
A01394-Dylight488

100 μg Dylight488 conjugated

$570
A01394-Dylight550

100 μg Dylight550 conjugated

$570
A01394-Dylight594

100 μg Dylight594 conjugated

$570
A01394-FITC

100 μg FITC conjugated

$570
A01394-HRP

100 μg HRP conjugated

$570
A01394-APC

100 μg APC conjugated

$670
A01394-PE

100 μg PE conjugated

$670
A01394-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A01394
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.