Anti-KIAA0652/ATG13 Antibody Picoband™

ATG13 antibody

Boster Bio Anti-KIAA0652/ATG13 Antibody Picoband™ catalog # PB9480. Tested in WB applications. This antibody reacts with Human, Mouse.

Product Info Summary

SKU: PB9480
Size: 100 μg/vial
Reactive Species: Human, Mouse
Host: Rabbit
Application: WB

Product Name

Anti-KIAA0652/ATG13 Antibody Picoband™

View all ATG13 Antibodies

SKU/Catalog Number

PB9480

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-KIAA0652/ATG13 Antibody Picoband™ catalog # PB9480. Tested in WB applications. This antibody reacts with Human, Mouse.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-KIAA0652/ATG13 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9480)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human KIAA0652, identical to the related mouse sequence.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9480 is reactive to ATG13 in Human, Mouse

Applications

PB9480 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

56 kDa

Calculated molecular weight

56.572kDa

Background of ATG13

Autophagy-related protein 13, also known as ATG13, is a protein that in humans is encoded by the KIAA0652 gene. ATG13 is an autophagy factor required for phagosome formation. It is located on 11p11.2. And ATG13 is a target of the TOR kinase signaling pathway that regulates autophagy through phosphorylation of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse

Validation Images & Assay Conditions

Gene/Protein Information For ATG13 (Source: Uniprot.org, NCBI)

Gene Name

ATG13

Full Name

Autophagy-related protein 13

Weight

56.572kDa

Superfamily

ATG13 family

Alternative Names

autophagy-related protein 13; autophagy related 13; KIAA0652 ATG13 KIAA0652, PARATARG8 autophagy related 13 autophagy-related protein 13|ATG13 autophagy related 13 homolog

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on ATG13, check out the ATG13 Infographic

ATG13 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ATG13: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB9480

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-KIAA0652/ATG13 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-KIAA0652/ATG13 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-KIAA0652/ATG13 Antibody Picoband™

Question

I was wanting to use your anti-KIAA0652/ATG13 antibody for WB for mouse brain on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse brain identification?

Verified Customer

Verified customer

Asked: 2020-04-17

Answer

It shows on the product datasheet, PB9480 anti-KIAA0652/ATG13 antibody has been validated for WB on human, mouse tissues. We have an innovator award program that if you test this antibody and show it works in mouse brain in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-04-17

Question

We are currently using anti-KIAA0652/ATG13 antibody PB9480 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse. Is it likely that the antibody can work on goat tissues as well?

Verified Customer

Verified customer

Asked: 2019-12-24

Answer

The anti-KIAA0652/ATG13 antibody (PB9480) has not been validated for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-12-24

Question

Is this PB9480 anti-KIAA0652/ATG13 antibody reactive to the isotypes of ATG13?

T. Taylor

Verified customer

Asked: 2019-08-20

Answer

The immunogen of PB9480 anti-KIAA0652/ATG13 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human KIAA0652 (488-517aa MAEDLDSLPEKLAVHEKNVREFDAFVETLQ), identical to the related mouse sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-08-20

Question

I see that the anti-KIAA0652/ATG13 antibody PB9480 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2018-02-06

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2018-02-06

Order DetailsPrice
PB9480

100μg

$370
PB9480-10ug

10μg sample (liquid)

$99
PB9480-Biotin

100 μg Biotin conjugated

$570
PB9480-Cy3

100 μg Cy3 conjugated

$570
PB9480-Dylight488

100 μg Dylight488 conjugated

$570
PB9480-Dylight550

100 μg Dylight550 conjugated

$570
PB9480-Dylight594

100 μg Dylight594 conjugated

$570
PB9480-FITC

100 μg FITC conjugated

$570
PB9480-HRP

100 μg HRP conjugated

$570
PB9480-APC

100 μg APC conjugated

$670
PB9480-PE

100 μg PE conjugated

$670
PB9480-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9480
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.