Anti-MRP2/ABCC2 Antibody Picoband™

MRP2 antibody

Boster Bio Anti-MRP2/ABCC2 Antibody Picoband™ catalog # A00974-1. Tested in IHC, WB applications. This antibody reacts with Human, Monkey, Mouse. Cited in 7 publication(s).

Product Info Summary

SKU: A00974-1
Size: 100 μg/vial
Reactive Species: Human, Monkey, Mouse
Host: Rabbit
Application: IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-MRP2/ABCC2 Antibody Picoband™

View all MRP2 Antibodies

SKU/Catalog Number

A00974-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-MRP2/ABCC2 Antibody Picoband™ catalog # A00974-1. Tested in IHC, WB applications. This antibody reacts with Human, Monkey, Mouse.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-MRP2/ABCC2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00974-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence of human MRP2/ABCC2 (AIRHDCNFDKAMQFSEASFTWEHDSEATVRDVNLD).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A00974-1 is reactive to ABCC2 in Human, Monkey, Mouse

Applications

A00974-1 is guaranteed for IHC, WB Boster Guarantee

Background of MRP2

Multidrug resistance-associated protein 2 (MRP2), also called canalicular multispecific organic anion transporter 1 (cMOAT) or ATP-binding cassette sub-family C member 2 (ABCC2), is a protein that in humans is encoded by the ABCC2 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is expressed in the canalicular (apical) part of the hepatocyte and functions in biliary transport. Substrates include anticancer drugs such as vinblastine; therefore, this protein appears to contribute to drug resistance in mammalian cells. Several different mutations in this gene have been observed in patients with Dubin-Johnson syndrome (DJS), an autosomal recessive disorder characterized by conjugated hyperbilirubinemia.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For ABCC2 (Source: Uniprot.org, NCBI)

Uniprot ID

Q92887

Gene ID

1244

Gene Name

ABCC2

Full Name

Canalicular multispecific organic anion transporter 1

Weight

174.207kDa

Superfamily

ABC transporter superfamily

Alternative Names

ATP-binding cassette, sub-family C (CFTR/MRP), member 2; Canalicular multidrug resistance protein; canalicular multispecific organic anion transporter 1; CMOAT1; CMOATABC30; cMRP; DJS; KIAA1010; MRP2ATP-binding cassette sub-family C member 2; Multidrug resistance-associated protein 2 ABCC2 ABC30, CMOAT, DJS, MRP2, cMRP ATP binding cassette subfamily C member 2 canalicular multispecific organic anion transporter 1|ATP-binding cassette, sub-family C (CFTR/MRP), member 2|canalicular multidrug resistance protein|multidrug resistance-associated protein 2

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on ABCC2, check out the ABCC2 Infographic

ABCC2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ABCC2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected]

A00974-1 has been cited in 7 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Cisplatin-induced CCL5 secretion from CAFs promotes cisplatin-resistance in ovarian cancer via regulation of the STAT3 and PI3K/Akt signaling pathways

Lentivirus-mediated RNAi silencing targeting ABCC2 increasing the sensitivity of a human nasopharyngeal carcinoma cell line against cisplatin

The Herbal Constituents in An-Gong-Niu-Huang Wan (AGNH) Protect against Cinnabar- and Realgar-Induced Hepatorenal Toxicity and Accumulations of Mercury and Arsenic in Mice

Association of ABCC2 and CDDP-Resistance in Two Sublines Resistant to CDDP Derived from a Human Nasopharyngeal Carcinoma Cell Line

Songsong Wang,Xiao Xiao,Ao Li,Peng Li,"The Herbal Constituents in An-Gong-Niu-Huang Wan (AGNH) Protect against Cinnabar- and Realgar-Induced Hepatorenal Toxicity and Accumulations of Mercury and Arsenic in Mice",Evidence-Based Complementary and Alternative Medicine,vol.2021,Article ID 5566078,9 pages,2021.https://doi.org/10.1155/2021/5566078
Species: Mouse
A00974-1 usage in article: APP:WB, SAMPLE:HEPATORENAL TISSUE, DILUTION:NA

Huang J,Wang Q,Chen M,Bi Y,Shi H,Zhou K. Effects of psoralen on hepatic bile acid transporters in rats. Hum Exp Toxicol.2020 Dec 15:960327120979346.doi:10.1177/0960327120979346. Epub ahead of print.PMID:33317360.
Species: Rat
A00974-1 usage in article: APP:WB, SAMPLE:LIVER TISSUE, DILUTION:1:500

Association of ABCC2 and CDDP-resistance in two sublines resistant to CDDP derived from a human nasopharyngeal carcinoma cell line

Have you used Anti-MRP2/ABCC2 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-MRP2/ABCC2 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

1 Customer Q&As for Anti-MRP2/ABCC2 Antibody Picoband™

Question

We are currently using anti-MRP2/ABCC2 antibody A00974-1 for human tissue, and we are well pleased with the IHC-P results. The species of reactivity given in the datasheet says human, monkey, mouse. Is it true that the antibody can work on monkey tissues as well?

Verified Customer

Verified customer

Asked: 2019-09-09

Answer

The anti-MRP2/ABCC2 antibody (A00974-1) has not been validated for cross reactivity specifically with monkey tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-09-09

Size

Conjugation

Total: $315

SKU:A00974-1

Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
A00974-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$315.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.