Product Info Summary
SKU: | A00066-1 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, IF, IHC, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-HMGB1 Antibody Picoband™
View all HMGB1/HMG-1 Antibodies
SKU/Catalog Number
A00066-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-HMGB1 Antibody Picoband™ catalog # A00066-1. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-HMGB1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00066-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human HMGB1, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
A00066-1 is reactive to HMGB1 in Human, Mouse, Rat
Applications
A00066-1 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee
Observed Molecular Weight
25 kDa
Calculated molecular weight
24.894kDa
Background of HMGB1/HMG-1
High mobility group box 1 protein, also known as high-mobility group protein 1 (HMG-1) and amphoterin, is a protein that in humans is encoded by the HMGB1 gene. This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of HMGB1 using anti-HMGB1 antibody (A00066-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysates,
Lane 2: human 293T whole cell lysates,
Lane 3: human K562 whole cell lysates,
Lane 4: human Jurkat whole cell lysates,
Lane 5: rat brain tissue lysates,
Lane 6: mouse brain tissue lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-HMGB1 antigen affinity purified polyclonal antibody (Catalog # A00066-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for HMGB1 at approximately 25 kDa. The expected band size for HMGB1 is at 25 kDa.
Click image to see more details
Figure 2. IHC analysis of HMGB1 using anti-HMGB1 antibody (A00066-1).
HMGB1 was detected in paraffin-embedded section of mouse intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-HMGB1 Antibody (A00066-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of HMGB1 using anti-HMGB1 antibody (A00066-1).
HMGB1 was detected in paraffin-embedded section of mouse liver tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-HMGB1 Antibody (A00066-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of HMGB1 using anti-HMGB1 antibody (A00066-1).
HMGB1 was detected in paraffin-embedded section of rat intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-HMGB1 Antibody (A00066-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 5. IHC analysis of HMGB1 using anti-HMGB1 antibody (A00066-1).
HMGB1 was detected in paraffin-embedded section of rat liver tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-HMGB1 Antibody (A00066-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 6. IHC analysis of HMGB1 using anti-HMGB1 antibody (A00066-1).
HMGB1 was detected in paraffin-embedded section of human mammary cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-HMGB1 Antibody (A00066-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 7. IHC analysis of HMGB1 using anti-HMGB1 antibody (A00066-1).
HMGB1 was detected in paraffin-embedded section of human placenta tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-HMGB1 Antibody (A00066-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 8. IF analysis of HMGB1 using anti-HMGB1 antibody (A00066-1).
HMGB1 was detected in immunocytochemical section of U20S cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2μg/mL rabbit anti-HMGB1 Antibody (A00066-1) overnight at 4°C. DyLight®594 Conjugated Goat Anti-Rabbit IgG (BA1142) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 9. IF analysis of HMGB1 using anti-HMGB1 antibody (A00066-1).
HMGB1 was detected in immunocytochemical section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2μg/mL rabbit anti-HMGB1 Antibody (A00066-1) overnight at 4°C. DyLight®594 Conjugated Goat Anti-Rabbit IgG (BA1142) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 10. Flow Cytometry analysis of THP-1 cells using anti-HMGB1 antibody (A00066-1).
Overlay histogram showing THP-1 cells stained with A00066-1 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-HMGB1 Antibody (A00066-1, 1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Protein Target Info & Infographic
Gene/Protein Information For HMGB1 (Source: Uniprot.org, NCBI)
Gene Name
HMGB1
Full Name
High mobility group protein B1
Weight
24.894kDa
Superfamily
HMGB family
Alternative Names
Amphoterin; high mobility group box 1; High mobility group protein 1; high mobility group protein B1; high-mobility group (nonhistone chromosomal) protein 1; high-mobility group box 1; HMG1; HMG-1; HMG1DKFZp686A04236; HMG3; HMGB1; SBP-1; Sulfoglucuronyl carbohydrate binding protein HMGB1 HMG-1, HMG1, HMG3, SBP-1 high mobility group box 1 high mobility group protein B1|Amphoterin|Sulfoglucuronyl carbohydrate binding protein|high-mobility group (nonhistone chromosomal) protein 1
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on HMGB1, check out the HMGB1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for HMGB1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-HMGB1 Antibody Picoband™ (A00066-1)
Hello CJ!
A00066-1 has been cited in 11 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Association of Upregulated HMGB1 and c-IAP2 Proteins With Hepatocellular Carcinoma Development and Progression
Extracellular HMGB1 blockade inhibits tumor growth through profoundly remodeling immune microenvironment and enhances checkpoint inhibitor-based immunotherapy
Effects of Ethyl Pyruvate in Preventing the Development of Diet-induced Atherosclerosis by Blocking the HMGB1 Expression in ApoE-Deficient Mice
Hubert P,Roncarati P, Demoulin S, Pilard C, Ancion M, Reynders C, Lerho T, Bruyere D, Lebeau A, Radermecker C, Meunier M, Nokin MJ, Hendrick E, Peulen O, Delvenne P, Herfs M. Extracellular HMGB1 blockade inhibits tumor growth through profoundly remodeling immune microenvironment and enhances checkpoint inhibitor-based immunotherapy. J Immunother Cancer. 2021 Mar;9(3):e001966. doi: 10.1136/jitc-2020-001966. PMID: 33712445.
Species: Human,Mouse
A00066-1 usage in article: APP:WB, SAMPLE:MOUSE BREAST CANCER CELLS, DILUTION:1:1000
Wen Y,Sun HY,Tan Z,Liu RH,Huang SQ,Chen GY,Qi H,Tang LJ.Abdominal paracentesis drainage ameliorates myocardial injury in severe experimental pancreatitis rats through suppressing oxidative stress.World J Gastroenterol.2020 Jan 7;26(1):35-54.doi:10.3748/wj
Species: Rat
A00066-1 usage in article: APP:WB, SAMPLE:PAAF CELLS, DILUTION:NA
MicroRNA-205%u20115b inhibits HMGB1 expression in LPS-induced sepsis
Propofol inhibits the release of interleukin-6, 8 and tumor necrosis factor-? correlating with high-mobility group box 1 expression in lipopolysaccharides-stimulated RAW 264.7 cells
Galantamine protects against lipopolysaccharide-induced acute lung injury in rats
The Protective Role of Interleukin-33 in Myocardial Ischemia and Reperfusion Is Associated with Decreased HMGB1 Expression and Up-Regulation of the P38 MAPK Signaling Pathway
Association of Upregulated HMGB1 and c-IAP2 Proteins With Hepatocellular Carcinoma Development and Progression
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-HMGB1 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Anti-HMGB1 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
17 Customer Q&As for Anti-HMGB1 Antibody Picoband™
Question
What tissue is recommend as a positive control for A00066-1?
Verified customer
Asked: 2021-01-13
Answer
For the Anti-HMGB1 Antibody Picoband™ (A00066-1), the following tissue can be used as positive controls in IHC; mouse intestine mouse liver rat intestine rat liver human mammary cancer human placenta Our lab tested these tissue samples and observed positive signal. https://www.bosterbio.com/anti-hmgb1-picoband-trade-antibody-a00066-1-boster.html#product-image-1
Boster Scientific Support
Answered: 2021-01-14
Question
I see that the anti-HMGB1 antibody A00066-1 works with WB, what is the protocol used to produce the result images on the product page?
J. Dhar
Verified customer
Asked: 2020-03-19
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2020-03-19
Question
Do you have a BSA free version of anti-HMGB1 antibody A00066-1 available?
Verified Customer
Verified customer
Asked: 2019-12-10
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-HMGB1 antibody A00066-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-12-10
Question
We are currently using anti-HMGB1 antibody A00066-1 for human tissue, and we are well pleased with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on monkey tissues as well?
Verified Customer
Verified customer
Asked: 2019-11-28
Answer
The anti-HMGB1 antibody (A00066-1) has not been tested for cross reactivity specifically with monkey tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-11-28
Question
Our lab were content with the WB result of your anti-HMGB1 antibody. However we have been able to see positive staining in liver nucleus using this antibody. Is that expected? Could you tell me where is HMGB1 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2019-07-03
Answer
According to literature, liver does express HMGB1. Generally HMGB1 expresses in nucleus. Regarding which tissues have HMGB1 expression, here are a few articles citing expression in various tissues:
Brain, Cervix, and Testis, Pubmed ID: 15489334
Cerebellum, Pubmed ID: 14702039
Cervix carcinoma, Pubmed ID: 18669648, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Liver, Pubmed ID: 24275569
Mammary carcinoma, Pubmed ID: 9150946
Small intestine, Pubmed ID: 17974005
Boster Scientific Support
Answered: 2019-07-03
Question
I am interested in to test anti-HMGB1 antibody A00066-1 on mouse small intestine for research purposes, then I may be interested in using anti-HMGB1 antibody A00066-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
D. Walker
Verified customer
Asked: 2019-05-03
Answer
The products we sell, including anti-HMGB1 antibody A00066-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-05-03
Question
Is a blocking peptide available for product anti-HMGB1 antibody (A00066-1)?
V. Parker
Verified customer
Asked: 2019-04-22
Answer
We do provide the blocking peptide for product anti-HMGB1 antibody (A00066-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-04-22
Question
Would A00066-1 anti-HMGB1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2018-12-18
Answer
You can see on the product datasheet, A00066-1 anti-HMGB1 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2018-12-18
Question
We have been able to see staining in mouse small intestine. Any tips? Is anti-HMGB1 antibody supposed to stain small intestine positively?
Verified Customer
Verified customer
Asked: 2018-09-24
Answer
According to literature small intestine does express HMGB1. According to Uniprot.org, HMGB1 is expressed in kidney, cerebellum, small intestine, brain, cervix testis, mammary carcinoma, cervix carcinoma, cervix carcinoma erythroleukemia, liver, among other tissues. Regarding which tissues have HMGB1 expression, here are a few articles citing expression in various tissues:
Brain, Cervix, and Testis, Pubmed ID: 15489334
Cerebellum, Pubmed ID: 14702039
Cervix carcinoma, Pubmed ID: 18669648, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Liver, Pubmed ID: 24275569
Mammary carcinoma, Pubmed ID: 9150946
Small intestine, Pubmed ID: 17974005
Boster Scientific Support
Answered: 2018-09-24
Question
Would anti-HMGB1 antibody A00066-1 work for WB with small intestine?
Verified Customer
Verified customer
Asked: 2017-10-30
Answer
According to the expression profile of small intestine, HMGB1 is highly expressed in small intestine. So, it is likely that anti-HMGB1 antibody A00066-1 will work for WB with small intestine.
Boster Scientific Support
Answered: 2017-10-30
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for small intestine using anti-HMGB1 antibody A00066-1. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2017-09-26
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2017-09-26
Question
We are interested in using your anti-HMGB1 antibody for negative regulation of rna polymerase ii transcriptional preinitiation complex assembly studies. Has this antibody been tested with western blotting on mouse liver? We would like to see some validation images before ordering.
V. Anderson
Verified customer
Asked: 2017-09-18
Answer
Thank you for your inquiry. This A00066-1 anti-HMGB1 antibody is validated on mouse liver, 22rv1 whole cell lysates, hela whole cell lysates. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2017-09-18
Question
Here is the WB image, lot number and protocol we used for small intestine using anti-HMGB1 antibody A00066-1. Please let me know if you require anything else.
K. Singh
Verified customer
Asked: 2016-12-28
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2016-12-28
Question
Is this A00066-1 anti-HMGB1 antibody reactive to the isotypes of HMGB1?
K. Moore
Verified customer
Asked: 2016-07-04
Answer
The immunogen of A00066-1 anti-HMGB1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human HMGB1 (124-154aa DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2016-07-04
Question
I was wanting to use your anti-HMGB1 antibody for WB for mouse small intestine on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse small intestine identification?
E. Krishna
Verified customer
Asked: 2015-10-27
Answer
It shows on the product datasheet, A00066-1 anti-HMGB1 antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse small intestine in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2015-10-27
Question
We have tried in the past anti-HMGB1 antibody for IHC on liver in a previous project. I am using rat, and We want to use the antibody for WB next. We need examining liver as well as cervix testis in our next experiment. Do you have any suggestion on which antibody would work the best for WB?
V. Carter
Verified customer
Asked: 2015-08-28
Answer
I looked at the website and datasheets of our anti-HMGB1 antibody and I see that A00066-1 has been tested on rat in both IHC and WB. Thus A00066-1 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2015-08-28
Question
I have a question about product A00066-1, anti-HMGB1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
L. Edwards
Verified customer
Asked: 2014-05-29
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00066-1 anti-HMGB1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2014-05-29