Product Info Summary
SKU: | A04784-1 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, IF, IHC, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Hyaluronan synthase 1/HAS1 Antibody Picoband™
View all Hyaluronan synthase 1 Antibodies
SKU/Catalog Number
A04784-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Hyaluronan synthase 1/HAS1 Antibody Picoband™ catalog # A04784-1. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Hyaluronan synthase 1/HAS1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04784-1)
Host
Rabbit
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Hyaluronan synthase 1/HAS1, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A04784-1 is reactive to HAS1 in Human, Mouse, Rat
Applications
A04784-1 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee
Observed Molecular Weight
70 kDa
Calculated molecular weight
64.832kDa
Background of Hyaluronan synthase 1
Hyaluronan synthase 1 is an enzyme that in humans is encoded by the HAS1 gene. This gene is mapped to 19q13.41. Hyaluronan or hyaluronic acid (HA) is a high molecular weight unbranched polysaccharide synthesized by a wide variety of organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternating glucuronic acid and N-acetylglucosamine residues that are linked by beta-1-3 and beta-1-4 glycosidic bonds. It serves a variety of functions, including space filling, lubrication of joints, and provision of a matrix through which cells can migrate. HA is actively produced during wound healing and tissue repair to provide a framework for ingrowth of blood vessels and fibroblasts. AS1 is a member of the newly identified vertebrate gene family encoding putative hyaluronan synthases, and its amino acid sequence shows significant homology to the hasA gene product of Streptococcus pyogenes, a glycosaminoglycan synthetase (DG42) from Xenopus laevis, and a recently described murine hyaluronan synthase.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Immunocytochemistry/Immunofluorescence, 2μg/ml
Flow Cytometry, 1-3μg/1x106 cells
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of HAS1 using anti-HAS1 antibody (A04784-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human SHG-44 whole cell lysates,
Lane 2: human THP-1 whole cell lysates,
Lane 3: rat brain tissue lysates,
Lane 4: rat smooth muscle tissue lysates,
Lane 5: rat ovary tissue lysates,
Lane 6: mouse brain tissue lysates,
Lane 7: mouse smooth muscle tissue lysates,
Lane 8: mouse ovary tissue lysates,
Lane 9: mouse small intestine tissue lysates,
Lane 10: mouse Neuro-2a whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-HAS1 antigen affinity purified polyclonal antibody (Catalog # A04784-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for HAS1 at approximately 70KD. The expected band size for HAS1 is at 65KD.
Click image to see more details
Figure 2. IHC analysis of HAS1 using anti-HAS1 antibody (A04784-1).
HAS1 was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ugμg/ml rabbit anti-HAS1 Antibody (A04784-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of HAS1 using anti-HAS1 antibody (A04784-1).
HAS1 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ugμg/ml rabbit anti-HAS1 Antibody (A04784-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of HAS1 using anti-HAS1 antibody (A04784-1).
HAS1 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ugμg/ml rabbit anti-HAS1 Antibody (A04784-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 5. IHC analysis of HAS1 using anti-HAS1 antibody (A04784-1).
HAS1 was detected in paraffin-embedded section of mouse spleen tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ugμg/ml rabbit anti-HAS1 Antibody (A04784-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 6. IHC analysis of HAS1 using anti-HAS1 antibody (A04784-1).
HAS1 was detected in paraffin-embedded section of rat small intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ugμg/ml rabbit anti-HAS1 Antibody (A04784-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 7. IF analysis of HAS1 using anti-HAS1 antibody (A04784-1).
HAS1 was detected in immunocytochemical section of U20S cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2μg/mL rabbit anti-HAS1 Antibody (A04784-1) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 8. IF analysis of HAS1 using anti-HAS1 antibody (A04784-1).
HAS1 was detected in immunocytochemical section of U20S cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2μg/mL rabbit anti-HAS1 Antibody (A04784-1) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 9. Flow Cytometry analysis of U-87MG cells using anti-HAS1 antibody (A04784-1).
Overlay histogram showing U-87MG cells stained with A04784-1 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-HAS1 Antibody (A04784-1,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Protein Target Info & Infographic
Gene/Protein Information For HAS1 (Source: Uniprot.org, NCBI)
Gene Name
HAS1
Full Name
Hyaluronan synthase 1
Weight
64.832kDa
Superfamily
NodC/HAS family
Alternative Names
HA synthase 1; HAS; huHAS1; hyaluronan synthase 1; hyaluronate synthase 1; hyaluronic acid synthase 1 HAS1 HAS hyaluronan synthase 1 hyaluronan synthase 1|HA synthase 1|hyaluronate synthase 1|hyaluronic acid synthase 1
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on HAS1, check out the HAS1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for HAS1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Hyaluronan synthase 1/HAS1 Antibody Picoband™ (A04784-1)
Hello CJ!
No publications found for A04784-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Hyaluronan synthase 1/HAS1 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Anti-Hyaluronan synthase 1/HAS1 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
13 Customer Q&As for Anti-Hyaluronan synthase 1/HAS1 Antibody Picoband™
Question
Would A04784-1 anti-Hyaluronan synthase 1/HAS1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2020-04-24
Answer
As indicated on the product datasheet, A04784-1 anti-Hyaluronan synthase 1/HAS1 antibody as been tested on IHC-P. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-04-24
Question
Is there a BSA free version of anti-Hyaluronan synthase 1/HAS1 antibody A04784-1 available?
Verified Customer
Verified customer
Asked: 2020-04-21
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Hyaluronan synthase 1/HAS1 antibody A04784-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-04-21
Question
My question regarding product A04784-1, anti-Hyaluronan synthase 1/HAS1 antibody . I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2020-03-24
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A04784-1 anti-Hyaluronan synthase 1/HAS1 antibody , we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2020-03-24
Question
We are currently using anti-Hyaluronan synthase 1/HAS1 antibody A04784-1 for rat tissue, and we are content with the IHC-P results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on monkey tissues as well?
Verified Customer
Verified customer
Asked: 2020-01-09
Answer
The anti-Hyaluronan synthase 1/HAS1 antibody (A04784-1) has not been tested for cross reactivity specifically with monkey tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-01-09
Question
Will anti-Hyaluronan synthase 1/HAS1 antibody A04784-1 work for IHC-P with fetal brain?
Verified Customer
Verified customer
Asked: 2019-12-13
Answer
According to the expression profile of fetal brain, HAS1 is highly expressed in fetal brain. So, it is likely that anti-Hyaluronan synthase 1/HAS1 antibody A04784-1 will work for IHC-P with fetal brain.
Boster Scientific Support
Answered: 2019-12-13
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for fetal brain using anti-Hyaluronan synthase 1/HAS1 antibody A04784-1. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-09-06
Answer
I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-09-06
Question
Is a blocking peptide available for product anti-Hyaluronan synthase 1/HAS1 antibody (A04784-1)?
Verified Customer
Verified customer
Asked: 2019-08-19
Answer
We do provide the blocking peptide for product anti-Hyaluronan synthase 1/HAS1 antibody (A04784-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-08-19
Question
I have attached the WB image, lot number and protocol we used for fetal brain using anti-Hyaluronan synthase 1/HAS1 antibody A04784-1. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-06-25
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-06-25
Question
Would anti-Hyaluronan synthase 1/HAS1 antibody A04784-1 work on bovine WB with layer of synovial tissue?
Verified Customer
Verified customer
Asked: 2018-10-05
Answer
Our lab technicians have not tested anti-Hyaluronan synthase 1/HAS1 antibody A04784-1 on bovine. You can run a BLAST between bovine and the immunogen sequence of anti-Hyaluronan synthase 1/HAS1 antibody A04784-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated bovine samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in bovine layer of synovial tissue in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2018-10-05
Question
Is this A04784-1 anti-Hyaluronan synthase 1/HAS1 antibody reactive to the isotypes of HAS1?
Verified Customer
Verified customer
Asked: 2018-07-16
Answer
The immunogen of A04784-1 anti-Hyaluronan synthase 1/HAS1 antibody is A synthetic peptide corresponding to a sequence of human HAS1 (NRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPA). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-07-16
Question
I was wanting to use your anti-Hyaluronan synthase 1/HAS1 antibody for IHC-P for rat fetal brain on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat fetal brain identification?
Verified Customer
Verified customer
Asked: 2018-06-06
Answer
You can see on the product datasheet, A04784-1 anti-Hyaluronan synthase 1/HAS1 antibody has been validated for Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat fetal brain in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2018-06-06
Question
I see that the anti-Hyaluronan synthase 1/HAS1 antibody A04784-1 works with IHC-P, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2017-10-17
Answer
You can find protocols for IHC-P on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2017-10-17
Question
We need to test anti-Hyaluronan synthase 1/HAS1 antibody A04784-1 on rat fetal brain for research purposes, then I may be interested in using anti-Hyaluronan synthase 1/HAS1 antibody A04784-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
H. Thomas
Verified customer
Asked: 2015-12-17
Answer
The products we sell, including anti-Hyaluronan synthase 1/HAS1 antibody A04784-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2015-12-17