Anti-P Glycoprotein/ABCB1 Antibody

Boster Bio Anti-P Glycoprotein/ABCB1 Antibody catalog # RP1034. Tested in IHC applications. This antibody reacts with Human, Mouse, Rat. Cited in 32 publication(s).

Product Info Summary

SKU: RP1034
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC

Product Name

Anti-P Glycoprotein/ABCB1 Antibody

See all MDR1/ABCB1 products

SKU/Catalog Number

RP1034

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-P Glycoprotein/ABCB1 Antibody catalog # RP1034. Tested in IHC applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-P Glycoprotein/ABCB1 Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # RP1034)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human P Glycoprotein (621-650aa IYFKLVTMQTAGNEVELENAADESKSEIDA), different from the related rat sequence by twelve amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

RP1034 is reactive to TP53 in Human, Mouse, Rat

Applications

RP1034 is guaranteed for IHC Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Frozen Section), 0.5-1μg/ml, Mouse, Rat, -
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat

Validation Images & Assay Conditions

Gene/Protein Information For TP53 (Source: Uniprot.Org, NCBI)

Uniprot ID

P08183

Gene ID

5243

Gene Name

TP53

Full Name

ATP-dependent translocase ABCB1

Weight

141.479kDa

Superfamily

ABC transporter superfamily

Alternative Names

ABC20; ABCB1; ABCB1B; ATP-binding cassette sub-family B member 1; ATP-binding cassette, sub-family B (MDR/TAP), member 1; CD243 antigen; CD243; CLCS; colchicin sensitivity; doxorubicin resistance; EC 3.6.3; EC 3.6.3.44; GP170; IBD13; MDR1; MDR1MGC163296; multidrug resistance protein 1; P-glycoprotein 1; P-gp; PGY1; PGY1P-GP ABCB1 ABC20, CD243, CLCS, GP170, MDR1, P-GP, PGY1, p-170 ATP binding cassette subfamily B member 1 ATP-dependent translocase ABCB1|ATP-binding cassette, sub-family B (MDR/TAP), member 1|P-glycoprotein 1|colchicin sensitivity|doxorubicin resistance|multidrug resistance protein 1|phospholipid transporter ABCB1

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on TP53, check out the TP53 Infographic

TP53 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for TP53: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

RP1034 has been cited in 32 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Panchamia, Shail. (2020). To Investigate The Impact Of Gut Bacteria On Efflux Transporter Expression And Function In Gastrointestinal Mucosae. Retrieved from the University of Minnesota Digital Conservancy, https://hdl.handle.net/11299/215018.
Species: Mouse
RP1034 usage in article: APP:IHC, SAMPLE:INTESTINE AND COLON TISSUE, DILUTION:1:200

The natural compound GL22, isolated from Ganoderma mushrooms, suppresses tumor growth by altering lipid metabolism and triggering cell death

Metronomic chemotherapy remodel cancer-associated fibroblasts to decrease chemoresistance of gastric cancer in nude mice

Acetazolamide Suppresses Multi-Drug Resistance-Related Protein 1 and P-Glycoprotein Expression by Inhibiting Aquaporins Expression in a Mesial Temporal Epilepsy Rat Model

Piwil2 is reactivated by HPV oncoproteins and initiates cell reprogramming via epigenetic regulation during cervical cancer tumorigenesis

P-glycoprotein Mediates Postoperative Peritoneal Adhesion Formation by Enhancing Phosphorylation of the Chloride Channel-3

Effects of human umbilical cord mesenchymal stem cell transplantation combined with minimally invasive hematoma aspiration on intracerebral hemorrhage in rats.

Lactotransferrin expression is downregulated and affects the mitogen-activated protein kinase pathway in gastric cancer

Correlation ofp53gene mutation and expression of P53 protein in cholangiocarcinoma

MDM4 Overexpressed in Acute Myeloid Leukemia Patients with Complex Karyotype and Wild-TypeTP53

Suspension culture combined with chemotherapeutic agents for sorting of breast cancer stem cells

The molecular mechanism of G2M cell cycle arrest induced by AFB1 in the jejunum

A novel polysaccharide from Sargassum integerrimum induces apoptosis in A549 cells and prevents angiogensis in vitro and in vivo

TALENs-directed?knockout?of the?full-length?transcription?factor?Nrf1? that?represses?malignantbehaviour?of?human?hepatocellular?carcinoma?(HepG2)?cells

A 20(S)-protopanoxadiol derivative overcomes multi-drug resistance by antagonizing ATP-binding cassette subfamily B member 1 transporter function

HOXB1 Is a Tumor Suppressor Gene Regulated by miR-3175 in Glioma

Dietary NiCl2 causes G2/M cell cycle arrest in the broiler's kidney

Expression of TP53, BCL-2, and VEGFA Genes in Esophagus Carcinoma and its Biological Significance

Effect of ligustilide on Ang II-induced hypertrophy in cardiomyocytes and the potential mechanisms

c?Ski activates cancer?associated fibroblasts to regulate breast cancer cell invasion

Feng D, Wu J, Tian Y, Zhou H, Zhou Y, Hu W, Zhao W, Wei H, Ling B, Ma C. Plos One. 2013 Nov 19;8(11):E80657. Doi: 10.1371/Journal.Pone.0080657. Ecollection 2013. Targeting Of Histone Deacetylases To Reactivate Tumour Suppressor Genes And Its Thera...

Li W, Wu D, Wei B, Wang S, Sun H, Li X, Zhang F, Zhang C, Xin Y. Afr J Tradit Complement Altern Med. 2014 Aug 23;11(5):99-104. Ecollection 2014. Anti-Tumor Effect Of Cactus Polysaccharides On Lung Squamous Carcinoma Cells (Sk-Mes-1).

Liu Xm, Yang Ff, Yuan Yf, Zhai R, Huo Lj. Plos One. 2013 May 16;8(5):E63680. Doi: 10.1371/Journal.Pone.0063680. Print 2013. Sumoylation Of Mouse P53B By Sumo-1 Promotes Its Pro-Apoptotic Function In Ovarian Granulosa Cells.

Li W, Wang W, Li Y, Wang W, Wang T, Li L, Han Z, Wang S, Ma D, Wang H. Plos One. 2014 Mar 12;9(3):E90114. Doi: 10.1371/Journal.Pone.0090114. Ecollection 2014. Proteomics Analysis Of Normal And Senescent Ng108-15 Cells: Grp78 Plays A Negative Role ...

Zhou L, Yang Y, Tian D, Wang Y. Oncol Rep. 2013 Mar;29(3):875-84. Doi: 10.3892/Or.2013.2227. Epub 2013 Jan 4. Oxidative Stress-Induced 1, N6-Ethenodeoxyadenosine Adduct Formation Contributes To Hepatocarcinogenesis.

Liang S, Peng X, Li X, Yang P, Xie L, Li Y, Du C, Zhang G. Oncotarget. 2015 Jan 20;6(2):1020-30. Silencing Of Cxcr4 Sensitizes Triple-Negative Breast Cancer Cells To Cisplatin.

Zhang J, Chen X, Shi G, Xie X, Liu H, Zhang X, Lai Y, Zuo Y, Chen Z, Liu S, Wang H. J Ovarian Res. 2013 Feb 6;6(1):9. Doi: 10.1186/1757-2215-6-9. Establishment Of A New Representative Model Of Human Ovarian Cancer In Mice.

Gao S, Liu Q, Wang X, Lin B, Zhang S. Med Oncol. 2010 Sep;27(3):960-7. Doi: 10.1007/S12032-009-9317-6. Epub 2009 Sep 23. Effects Of Lewis Y Antigen On The Gene Expression Of Multiple Drug Resistance-Associated Proteins In Human Ovarian Cancer Rmg-...

Wang X, Deng R, Lu Y, Xu Q, Yan M, Ye D, Chen W. Basic Clin Pharmacol Toxicol. 2013 Jan;112(1):25-33. Doi: 10.1111/J.1742-7843.2012.00921.X. Epub 2012 Aug 22. Gambogic Acid As A Non-Competitive Inhibitor Of Atp-Binding Cassette Transporter B1 Reve...

Zhang D, Fu M, Song C, Wang C, Lin X, Liu Y. Neural Regen Res. 2012 Oct 25;7(30):2347-53. Doi: 10.3969/J.Issn.1673-5374.2012.30.004. Expressions Of Apoptosis-Related Proteins In Rats With Focal Cerebral Ischemia After Angong Niuhuang Sticker Point...

Yang S, Wang H, Guo Y, Chen S, Zhang My, Shen J, Yu H, Miao J, Wang Hy, Wei W. Int J Biol Sci. 2013 Jul 5;9(6):637-48. Doi: 10.7150/Ijbs.6439. Print 2013. Rmp Plays Distinct Roles In The Proliferation Of Hepatocellular Carcinoma Cells And Normal H...

Wang Q, Xu Y, Zhou W, Zhong L, Wen Z, Yu H, Chen S, Shen J, Chen H, She Q, Jiang J, Miao J, Wei W. Int J Biol Sci. 2014 Nov 18;10(10):1181-92. Doi: 10.7150/Ijbs.10275. Ecollection 2014. The Viral Oncoprotein Hbx Of Hepatitis B Virus Promotes The G...

Have you used Anti-P Glycoprotein/ABCB1 Antibody?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-P Glycoprotein/ABCB1 Antibody

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-P Glycoprotein/ABCB1 Antibody

Question

We are currently using anti-P Glycoprotein/ABCB1 antibody RP1034 for rat tissue, and we are well pleased with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on goat tissues as well?

Verified Customer

Verified customer

Asked: 2020-01-22

Answer

The anti-P Glycoprotein/ABCB1 antibody (RP1034) has not been tested for cross reactivity specifically with goat tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-01-22

Question

I have a question about product RP1034, anti-P Glycoprotein/ABCB1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-10-28

Answer

It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free RP1034 anti-P Glycoprotein/ABCB1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-10-28

Question

I see that the anti-P Glycoprotein/ABCB1 antibody RP1034 works with IHC, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2018-12-20

Answer

You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2018-12-20

Question

Will anti-P Glycoprotein/ABCB1 antibody RP1034 work on bovine IHC with thalamus?

R. Zhao

Verified customer

Asked: 2013-05-29

Answer

Our lab technicians have not tested anti-P Glycoprotein/ABCB1 antibody RP1034 on bovine. You can run a BLAST between bovine and the immunogen sequence of anti-P Glycoprotein/ABCB1 antibody RP1034 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated bovine samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in bovine thalamus in IHC, you can get your next antibody for free.

Boster Scientific Support

Answered: 2013-05-29

Conjugation

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
RP1034
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.