Show Order Info
Pack Size:100μg/vial
Validated Species:Human, Mouse, Rat
Data & Images


Product Name Anti-P GlycoProtein Antibody
SKU/Catalog Number RP1034
Description Rabbit IgG polyclonal antibody for Multidrug resistance protein 1(ABCB1) detection. Tested with IHC-P, IHC-F in Human;Mouse;Rat.
Cite This Product Anti-P GlycoProtein Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # RP1034)
Replacement Item This antibody may replace the following items: sc-13131|sc-1517|sc-1517-R|sc-55510|sc-71557|sc-73354|sc-8313 from Santa Cruz Biotechnology.
Host Rabbit
Isotype N/A
Validated Species Human, Mouse, Rat
Application IHC

*Our Boster Guarantee covers the use of this product in the above tested applications.

**For positive and negative control design, consult "Tissue specificity" under Protein Target Info.

Recommended Detection Systems Boster recommends HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P) and IHC(F).
*Blocking peptide can be purchased at $50. Contact us for more information
**Boster also offers various secondary antibodies for Immunoflourescecne and IHC. Take advantage of the buy 1 primary antibody get 1 secondary antibody for free promotion for the entire year 2017!
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human P Glycoprotein(621-650aa IYFKLVTMQTAGNEVELENAADESKSEIDA), different from the related rat sequence by twelve amino acids.
Cross Reactivity No cross reactivity with other proteins
Pack Size 100μg/vial


Clonality Polyclonal
Form Lyophilized
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.
*carrier free antibody available upon request.
Concentration Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Purification Immunogen affinity purified.
Isotype N/A

Protein Target Info (Source:

You can check the tissue specificity below for information on selecting positive and negative control.

Gene Name TP53
Protein Name Multidrug resistance protein 1
Molecular Weight 141479 MW
Protein Function Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.
Tissue Specificity Expressed in liver, kidney, small intestine and brain.
Sequence Similarities Belongs to the ABC transporter superfamily. ABCB family. Multidrug resistance exporter (TC 3.A.1.201) subfamily.
Subcellular Localization Cell membrane ; Multi-pass membrane protein .
Uniprot ID P08183
Alternative Names Multidrug resistance protein 1;;ATP-binding cassette sub-family B member 1;P-glycoprotein 1;CD243;ABCB1;MDR1, PGY1;
Research Areas |signal transduction|metabolism|mitochondrial| metabolism|pathways and processes|mitochondrial metabolism|mitochondrial markers|
*if product is indicated to react with multiple species, protein info is based on the human gene.

Background for Multidrug resistance protein 1

P-GP, also called ABCB1 or PGY1, is a glycoprotein that in humans is encoded by the ABCB1 gene. It is mapped to 7q21.12. P-GP is a well-characterized ABC-transporter (which transports a wide variety of substrates across extra- and intracellular membranes) of the MDR/TAP subfamily. It is an important protein of the cell membrane that pumps many foreign substances out of cells. More formally, it is an ATP-dependent drug efflux pump with broad substrate specificity. P-GP is an ATP-dependent drug efflux pump forxenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood–brain barrier.

Anti-P GlycoProtein Antibody Images

Click the images to enlarge.

Anti-P GlycoProtein Antibody
Anti-P Glycoprotein Picoband antibody, RP1034-1.JPG
IHC(F): Mouse Intestine Tissue
Anti-P GlycoProtein Antibody
Anti-P Glycoprotein Picoband antibody, RP1034-2.JPG
IHC(F): Rat Kidney Tissue
Anti-P GlycoProtein Antibody
Anti-P Glycoprotein Picoband antibody, RP1034-3.JPG
IHC(P): Human Lung Cancer Tissue
Anti-P GlycoProtein Antibody
Anti-P Glycoprotein Picoband antibody, RP1034-4.JPG
IHC(P): Mouse Kidney Tissue
Anti-P GlycoProtein Antibody
Anti-P Glycoprotein Picoband antibody, RP1034-5.JPG
IHC(P): Rat Kidney Tissue
Write a review for RP1034


Gao S, Liu Q, Wang X, Lin B, Zhang S. Med Oncol. 2010 Sep;27(3):960-7. Doi: 10.1007/S12032-009-9317-6. Epub 2009 Sep 23. Effects Of Lewis Y Antigen On The Gene Expression Of Multiple Drug Resistance-Associated Proteins In Human Ovarian Cancer Rmg-...
Wang X, Deng R, Lu Y, Xu Q, Yan M, Ye D, Chen W. Basic Clin Pharmacol Toxicol. 2013 Jan;112(1):25-33. Doi: 10.1111/J.1742-7843.2012.00921.X. Epub 2012 Aug 22. Gambogic Acid As A Non-Competitive Inhibitor Of Atp-Binding Cassette Transporter B1 Reve...

Customer Q&As

Q: Do you offer BSA-free antibodies? Keyword: Bovine serum albumin, carrier protein, conjugation
A: Yes, please contact us at for more information about BSA-free antibodies and availability. The new BSA-free formula uses trehalose as a replacement to BSA. We have tested many alternative chemicals and found that trehalose protects the antibodies the best.
Q: Can I conjugate markers to this antibody? Can I link custom conjugates to this antibody? Keyword: conjugation
A: The antibody is stored with BSA and cannot be conjugated with markers. Carrier free antibodies are available upon request. Please contact
Q: What should I use for negative control?
A: Please contact us for negative control suggestions. You can also check expression databases such as genecards, uniprot etc. Due to logistic reasons, we do not sell serum or lysates that we use internally for positive or negative control.
Q: Where can I find troubleshooting information? What should I do if I have unexpected bands, high background, no signal, weak signal
A: You can find Boster's troubleshoot guides under tech support tab. Please contact us for further assistance on troubleshooting your experiment.
Q: What is the immunogen sequence of this antibody? Is this antibody polyclonal or monoclonal?
A: You can find the immunogen sequence under "Immunogen" and clonality in the product name.
Q: What is the expected band size? Why is it different than the observed band size?
A: The expected band size is predicted on the size of the protein. The actual band size may be affected by a few other factors including but not limited to:
1. Post-translational modification:phosphorylation, methylation, glycosylation etc. These modifications prevent SDS molecules from binding to the target protein and thus make the band size appear larger than expected
2. Post-translational cleavage: this can cause smaller bands and or multiple bands

3. Alternative splicing: the same gene can have alternative splicing patterns generating different size proteins, all with reactivities to the antibody.

4. Amino Acid R chain charge: SDS binds to positive charges. The different size and charge of the Amino Acid side chains can affect the amount of SDS binding and thus affect the observed band size.
5. Multimers: Multimers are usually broken up in reducing conditions. However if the interactions between the multimers are strong, the band may appear higher.,
Q: What is the suggested dilution ratio for Western Blot (WB), Immunohistochemistry (IHC) and or ELISA standards? What is the optimal pH for the sample?
A: Check the datasheet for the product for details on dilution ratios for different experiments. You can find the datasheet button on the right side of the product page.
Q: What is the protocol you used for your Western blotting (WB) and Immunohistochemistry (IHC)?
A: Check our protocols under the tech support tab.
Q: What are some alternative names that could be used to describe this product?
A: Some common names include but are not limited to abcb1 antibody, mdr1 antibody, p gp antibody