Anti-SLC10A1 Antibody Picoband™

SLC10A1 antibody

Boster Bio Anti-SLC10A1 Antibody Picoband™ catalog # PB9745. Tested in Flow Cytometry, IF, IHC, IHC-F, WB applications. This antibody reacts with Mouse, Rat. Cited in 1 publication(s).

Product Info Summary

SKU: PB9745
Size: 100 μg/vial
Reactive Species: Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC, IHC-F, WB

Product Name

Anti-SLC10A1 Antibody Picoband™

View all SLC10A1 Antibodies

SKU/Catalog Number

PB9745

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-SLC10A1 Antibody Picoband™ catalog # PB9745. Tested in Flow Cytometry, IF, IHC, IHC-F, WB applications. This antibody reacts with Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-SLC10A1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9745)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of mouse SLC10A1, different from the related human sequence by eighteen amino acids, and from the related rat sequence by three amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB9745 is reactive to SLC10A1 in Mouse, Rat

Applications

PB9745 is guaranteed for Flow Cytometry, IF, IHC, IHC-F, WB Boster Guarantee

Observed Molecular Weight

50 kDa

Calculated molecular weight

38.119kDa

Background of SLC10A1

Na+-taurocholate cotransporting polypeptide (NTCP), also known as SLC10A1 (Solute carrier family 10, member 1), is the major bile acid uptake system in human hepatocytes. NTCP and the ileal transporter ASBT (apical sodium-dependent bile acid transporter) are two sodium-dependent transporters critical for the enterohepatic circulation of bile acids. The hASBT gene is known to be activated by the glucocorticoid receptor (GR). Ho RH et al. indicates functionally important polymorphisms in NTCP exist and that the like lihood of being carriers of such polymorphisms is dependent on ethnicity.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, By Heat
Immunohistochemistry (Frozen Section), 0.5-1μg/ml
Immunofluorescence, 2μg/ml
Flow Cytometry, 1-3μg/1x106 cells

Validation Images & Assay Conditions

Gene/Protein Information For SLC10A1 (Source: Uniprot.org, NCBI)

Gene Name

SLC10A1

Full Name

Sodium/bile acid cotransporter

Weight

38.119kDa

Superfamily

bile acid:sodium symporter (BASS) (TC 2.A.28) family

Alternative Names

Cell growth-inhibiting gene 29 protein; Na(+)/bile acid cotransporter; Na(+)/taurocholate transport protein; Na/taurocholate cotransporting polypeptide; NTCP; NTCP1; NTCPgrowth-inhibiting protein 29; sodium/bile acid cotransporter; sodium/taurocholate cotransporter; Sodium/taurocholate cotransporting polypeptide; solute carrier family 10 (sodium/bile acid cotransporter family), member 1; Solute carrier family 10 member 1 SLC10A1 NTCP solute carrier family 10 member 1 sodium/bile acid cotransporter|Na(+)/bile acid cotransporter|Na(+)/taurocholate transport protein|Na/taurocholate cotransporting polypeptide|cell growth-inhibiting gene 29 protein|growth-inhibiting protein 29|sodium/taurocholate cotransporter|sodium/taurocholate cotransporting polypeptide|solute carrier family 10 (sodium/bile acid cotransporter family), member 1|solute carrier family 10 (sodium/bile acid cotransporter), member 1

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on SLC10A1, check out the SLC10A1 Infographic

SLC10A1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SLC10A1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

PB9745 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Biomimetic niches reveal the minimal cues to trigger apical lumen formation in single hepatocytes
Species: Rat

Have you used Anti-SLC10A1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-SLC10A1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

2 Customer Q&As for Anti-SLC10A1 Antibody Picoband™

Question

I am inquiring regarding PB9745. I was kindly wondering if any validation studies have been performed for the specificity of this antibody for human NTCP. Is it known whether or not this antibody potentially cross-reacts with human proteins other than NTCP?

Verified customer

Asked: 2022-08-05

Answer

Thank you for your inquiry. Our lab hasn't experimentally validated cross-reactivity with human proteins other than NTCP. The immunogen sequence for PB9745 is EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK.

Boster Scientific Support

Answered: 2022-08-05

Question

We are currently using anti-SLC10A1 antibody PB9745 for mouse tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on zebrafish tissues as well?

Verified Customer

Verified customer

Asked: 2019-04-03

Answer

The anti-SLC10A1 antibody (PB9745) has not been tested for cross reactivity specifically with zebrafish tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-04-03

Order DetailsPrice
PB9745

100μg

$370
PB9745-10ug

10μg sample (liquid)

$99
PB9745-Biotin

100 μg Biotin conjugated

$570
PB9745-Cy3

100 μg Cy3 conjugated

$570
PB9745-Dylight488

100 μg Dylight488 conjugated

$570
PB9745-Dylight550

100 μg Dylight550 conjugated

$570
PB9745-Dylight594

100 μg Dylight594 conjugated

$570
PB9745-FITC

100 μg FITC conjugated

$570
PB9745-HRP

100 μg HRP conjugated

$570
PB9745-APC

100 μg APC conjugated

$670
PB9745-PE

100 μg PE conjugated

$670
PB9745-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9745
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.