Click image to see more details
Product Info Summary
| SKU: | PROTP41246 |
|---|---|
| Size: | 2ug, 10ug, 0.1mg |
| Origin Species: | Rabbit |
| Source: | Baculovirus, insect cells |
Customers Who Bought This Also Bought
Product info
Product Name
MMP-9 Matrix Metalloproteinase-9 Rabbit Recombinant Protein
View all MMP-9 recombinant proteins
SKU/Catalog Number
PROTP41246
Size
2ug, 10ug, 0.1mg
Description
MMP-9 Rabbit Recombinant is a full length secreted protein (688 amino acids - a.a. 20-707). The MMP-9 is expressed in insect cells and fused to a 30 aa C-terminal Myc-His tag, having a total MW of 79.94kDa. Purified MMP9 protein appears at 95kDa on SDS-PAGE gel due to protein modification.
Storage & Handling
Store at 4°C if entire vial will be used within 2-4 weeks. Store frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
Cite This Product
MMP-9 Matrix Metalloproteinase-9 Rabbit Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP41246)
Form
Sterile Filtered clear solution.
Formulation
The MMP-9 solution (0.3mg/ml) contains 50mM Tris, 150mM NaCl, 10% Glycerol, pH 7.5.
Purity
Greater than 85.0% as determined by SDS-PAGE.
Predicted MW
78.458kDa
Amino Acid Sequence
APRRRQPTLVVFPGELRTRLTDRQLAEEYLFRYGYTRVASMHGDSQSLRLPLLLLQK HLSLPETGELDNATLEAMRAPRCGVPDVGKFQTFEGDLKWHHHNITYWIQNYSEDLP RDVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHA FPPGPGIQGDAHFDDEELWSLGKGVVVPTYFGNADGAPCHFPFTFEGRSYTACTTD GRSDGMAWCSTTADYDTDRRFGFCPSERLYTQDGNADGKPCEFPFIFQGRTYSACT TDGRSDGHRWCATTASYDKDKLYGFCPTRADSTVVGGNSAGELCVFPFVFLGKEYS SCTSEGRRDGRLWCATTSNFDSDKKWGFCPDKGYSLFLVAAHEFGHALGLDHSSVP ERLMYPMYRYLEGSPLHEDDVRGIQHLYGPNPNPQPPATTTPEPQPTAPPTACPTWP ATVRPSEHPTTSPTGAPSAGPTGPPTASPSAAPTASLDPAEDVCNVNVFDAIAEIGNK LHVFKDGRYWRFSEGSGRRPQGPFLIADTWPALPAKLDSAFEEPLTKKLFFFSGRQV WVYTGASVLGPRRLDKLGLGPEVPHVTGALPRAGGKVLLFGAQRFWRFDVKTQTVD SRSGAPVDQMFPGVPLNTHDVFQYREKAYFCQDRFFWRVSTRNEVNLVDQVGYVS FDILHCPED
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For MMP9 (Source: Uniprot.org, NCBI)
Gene Name
MMP9
Full Name
Matrix metalloproteinase-9
Weight
78.458kDa
Superfamily
peptidase M10A family
Alternative Names
92 kDa gelatinase; 92 kDa type IV collagenase; CLG4B; EC 3.4.24; EC 3.4.24.35; Gelatinase B; GELB; macrophage gelatinase; MANDP2; matrix metallopeptidase 9; matrix metalloproteinase 9; matrix metalloproteinase-9; MMP9; MMP-9; type V collagenase MMP9 CLG4B, GELB, MANDP2, MMP-9 matrix metallopeptidase 9 matrix metalloproteinase-9|macrophage gelatinase|matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)|matrix metalloproteinase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)|type V collagenase
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on MMP9, check out the MMP9 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for MMP9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For MMP-9 Matrix Metalloproteinase-9 Rabbit Recombinant Protein (PROTP41246)
Hello CJ!
No publications found for PROTP41246
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used MMP-9 Matrix Metalloproteinase-9 Rabbit Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review MMP-9 Matrix Metalloproteinase-9 Rabbit Recombinant Protein
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
