Anti-DC-SIGN/CD209 Antibody Picoband™

CD209 antibody

Boster Bio Anti-DC-SIGN/CD209 Antibody Picoband™ catalog # A01025-2. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human. Cited in 1 publication(s).

Product Info Summary

SKU: A01025-2
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: Flow Cytometry, IHC, WB

Product Name

Anti-DC-SIGN/CD209 Antibody Picoband™

View all CD209 Antibodies

SKU/Catalog Number

A01025-2

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-DC-SIGN/CD209 Antibody Picoband™ catalog # A01025-2. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-DC-SIGN/CD209 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01025-2)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human DC-SIGN.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A01025-2 is reactive to CD209 in Human

Applications

A01025-2 is guaranteed for Flow Cytometry, IHC, WB Boster Guarantee

Observed Molecular Weight

46 kDa

Calculated molecular weight

45.775kDa

Background of CD209

DC-SIGN (Dendritic Cell-Specific Intercellular adhesion molecule-3-Grabbing Non-integrin) also known as CD209 (Cluster of Differentiation 209) is a protein which in humans is encoded by the CD209 gene. This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene. DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Flow Cytometry, 1-3μg/1x106 cells

Validation Images & Assay Conditions

Gene/Protein Information For CD209 (Source: Uniprot.org, NCBI)

Gene Name

CD209

Full Name

CD209 antigen

Weight

45.775kDa

Alternative Names

CD209 antigendendritic cell-specific intracellular adhesion molecules (ICAM)-3 grabbingnon-integrin; CD209 molecule; CD209; CDSIGNHIV gpl20-binding protein; CLEC4L; CLEC4LC-type lectin domain family 4 member L; DCSIGN; DC-SIGN; DC-SIGN1; DC-SIGN1C-type lectin domain family 4, member L; DC-SIGNMGC129965; Dendritic cell-specific ICAM-3-grabbing non-integrin 1 CD209 CDSIGN, CLEC4L, DC-SIGN, DC-SIGN1 CD209 molecule CD209 antigen|C-type lectin domain family 4 member L|HIV gpl20-binding protein|dendritic cell-specific ICAM-3-grabbing non-integrin 1|dendritic cell-specific intercellular adhesion molecule-3-grabbing non-integrin|dendritic cell-specific intracellular adhesion molecules (ICAM)-3 grabbing non-integrin

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on CD209, check out the CD209 Infographic

CD209 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CD209: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

A01025-2 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Tongtian Ni,Lili Xu,Silei Sun et al.Fluid Resuscitation via Colon Alleviates Systemic Inflammation in Early Stage of Rats With Severe Acute Pancreatitis, 25 January 2021, PREPRINT (Version 1) available at Research Square [https://doi.org/10.21203/rs.3.rs-
Species: Rat
A01025-2 usage in article: APP:IHC, SAMPLE:COLON TISSUE, DILUTION:1:100

Have you used Anti-DC-SIGN/CD209 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-DC-SIGN/CD209 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-DC-SIGN/CD209 Antibody Picoband™

Question

I have attached the WB image, lot number and protocol we used for placenta using anti-DC-SIGN/CD209 antibody A01025-2. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2020-03-26

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-03-26

Question

We have tried in the past anti-DC-SIGN/CD209 antibody for IHC on uterus a few months ago. I am using mouse, and We want to use the antibody for Flow Cytometry next. My lab would like examining uterus as well as placenta in our next experiment. Could give a recommendation on which antibody would work the best for Flow Cytometry?

Verified Customer

Verified customer

Asked: 2020-01-03

Answer

I viewed the website and datasheets of our anti-DC-SIGN/CD209 antibody and I see that A01025-2 has been tested on mouse in both IHC and Flow Cytometry. Thus A01025-2 should work for your application. Our Boster satisfaction guarantee will cover this product for Flow Cytometry in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for Flow Cytometry detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2020-01-03

Question

Do you have a BSA free version of anti-DC-SIGN/CD209 antibody A01025-2 available?

Verified Customer

Verified customer

Asked: 2019-12-17

Answer

Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-DC-SIGN/CD209 antibody A01025-2 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-12-17

Question

Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for placenta using anti-DC-SIGN/CD209 antibody A01025-2. Let me know if you need anything else.

T. Carter

Verified customer

Asked: 2019-11-28

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-11-28

Question

I was wanting to use your anti-DC-SIGN/CD209 antibody for IHC for mouse placenta on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse placenta identification?

Verified Customer

Verified customer

Asked: 2019-11-15

Answer

You can see on the product datasheet, A01025-2 anti-DC-SIGN/CD209 antibody has been tested for Flow Cytometry, IHC, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse placenta in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-11-15

Question

Can you help my question with product A01025-2, anti-DC-SIGN/CD209 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-07-30

Answer

We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01025-2 anti-DC-SIGN/CD209 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-07-30

Question

I am interested in to test anti-DC-SIGN/CD209 antibody A01025-2 on mouse placenta for research purposes, then I may be interested in using anti-DC-SIGN/CD209 antibody A01025-2 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-07-12

Answer

The products we sell, including anti-DC-SIGN/CD209 antibody A01025-2, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-07-12

Question

We are currently using anti-DC-SIGN/CD209 antibody A01025-2 for mouse tissue, and we are happy with the ICC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on primate tissues as well?

Verified Customer

Verified customer

Asked: 2019-07-04

Answer

The anti-DC-SIGN/CD209 antibody (A01025-2) has not been tested for cross reactivity specifically with primate tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-07-04

Question

Will A01025-2 anti-DC-SIGN/CD209 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-06-18

Answer

You can see on the product datasheet, A01025-2 anti-DC-SIGN/CD209 antibody as been tested on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-06-18

Question

I am interested in using your anti-DC-SIGN/CD209 antibody for cd209 (dc-sign) signaling studies. Has this antibody been tested with western blotting on hela whole cell lysates? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2018-10-23

Answer

Thanks for your inquiry. This A01025-2 anti-DC-SIGN/CD209 antibody is validated on human placenta tissue, hela whole cell lysates, hepg2 whole cell lysates, a549 whole cell lysates, rat spleen tissue, mouse thymus tissue, intestinal cancer tissue. It is guaranteed to work for Flow Cytometry, IHC, ICC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2018-10-23

Question

We have been able to see staining in human adrenal gland. Do you have any suggestions? Is anti-DC-SIGN/CD209 antibody supposed to stain adrenal gland positively?

Verified Customer

Verified customer

Asked: 2018-05-10

Answer

From what I have seen in literature adrenal gland does express CD209. From what I have seen in Uniprot.org, CD209 is expressed in adrenal gland, placenta, uterus, among other tissues. Regarding which tissues have CD209 expression, here are a few articles citing expression in various tissues:
Placenta, Pubmed ID: 1518869
Uterus, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2018-05-10

Question

Would anti-DC-SIGN/CD209 antibody A01025-2 work for IHC with placenta?

Verified Customer

Verified customer

Asked: 2018-04-25

Answer

According to the expression profile of placenta, CD209 is highly expressed in placenta. So, it is likely that anti-DC-SIGN/CD209 antibody A01025-2 will work for IHC with placenta.

Boster Scientific Support

Answered: 2018-04-25

Question

Is this A01025-2 anti-DC-SIGN/CD209 antibody reactive to the isotypes of CD209?

L. Zhang

Verified customer

Asked: 2018-01-09

Answer

The immunogen of A01025-2 anti-DC-SIGN/CD209 antibody is A synthetic peptide corresponding to a sequence of human DC-SIGN (MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-01-09

Question

Is a blocking peptide available for product anti-DC-SIGN/CD209 antibody (A01025-2)?

L. Evans

Verified customer

Asked: 2017-03-30

Answer

We do provide the blocking peptide for product anti-DC-SIGN/CD209 antibody (A01025-2). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2017-03-30

Question

I see that the anti-DC-SIGN/CD209 antibody A01025-2 works with IHC, what is the protocol used to produce the result images on the product page?

D. Baker

Verified customer

Asked: 2015-06-30

Answer

You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2015-06-30

Question

My boss were satisfied with the WB result of your anti-DC-SIGN/CD209 antibody. However we have seen positive staining in placenta isoform 1: cell membrane using this antibody. Is that expected? Could you tell me where is CD209 supposed to be expressed?

S. Krishna

Verified customer

Asked: 2015-02-10

Answer

Based on literature, placenta does express CD209. Generally CD209 expresses in isoform 1: cell membrane. Regarding which tissues have CD209 expression, here are a few articles citing expression in various tissues:
Placenta, Pubmed ID: 1518869
Uterus, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2015-02-10

Order DetailsPrice
A01025-2

100μg

$370
A01025-2-10ug

10μg sample (liquid)

$99
A01025-2-Biotin

100 μg Biotin conjugated

$570
A01025-2-Cy3

100 μg Cy3 conjugated

$570
A01025-2-Dylight488

100 μg Dylight488 conjugated

$570
A01025-2-Dylight550

100 μg Dylight550 conjugated

$570
A01025-2-Dylight594

100 μg Dylight594 conjugated

$570
A01025-2-FITC

100 μg FITC conjugated

$570
A01025-2-HRP

100 μg HRP conjugated

$570
A01025-2-APC

100 μg APC conjugated

$670
A01025-2-PE

100 μg PE conjugated

$670
A01025-2-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A01025-2
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.