SKU A03142
Size 100μg/vial
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Ig Isotype N/A
Applications IHC, WB

Overview

Product Name Anti-GAD65/GAD2 Picoband™ Antibody
SKU/Catalog Number A03142
Storage & Handling At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Size 100μg/vial
Description Rabbit IgG polyclonal antibody for Glutamate decarboxylase 2(GAD2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Cite This Product Anti-GAD65/GAD2 Picoband™ Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A03142)
Host Rabbit
Contents/Buffer Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human GAD65 (131-164aa KVIDFHYPNELLQEYNWELADQPQNLEEILMHCQ), different from the related mouse and rat sequences by one amino acid.
Reactivity Human, Mouse, Rat

Assay Details

Assay Dilutions Overview

Concentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunohistochemistry(Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human

Boster's Secondary Antibodies And IHC, WB Kits

The following reagents are used to generate the images below.

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Images And Assay Conditions

/antibody/a03142 1 WB anti gad65 picoband antibody.jpg

Western blot analysis of GAD65 expression in rat brain extract (lane 1) and mouse brain extract (lane 2). GAD65 at 65KD was detected using rabbit anti- GAD65 Antigen Affinity purified polyclonal antibody (Catalog #A03142) at 0.5 μg/mL. The blot was developed using chemiluminescence (ECL) method (Catalog # EK1002).

/antibody/a03142 2 IHC anti gad65 picoband antibody.jpg

GAD65 was detected in paraffin-embedded sections of rat kidney tissues using rabbit anti- GAD65 Antigen Affinity purified polyclonal antibody (Catalog #) at 1 μg/mL. The immunohistochemical section was developed using SABC method (Catalog # SA1022).

/antibody/a03142 3 IHC anti gad65 picoband antibody.jpg

GAD65 was detected in paraffin-embedded sections of human intetsinal cancer tissues using rabbit anti- GAD65 Antigen Affinity purified polyclonal antibody (Catalog #) at 1 μg/mL. The immunohistochemical section was developed using SABC method (Catalog # SA1022).

/antibody/a03142 4 IHC anti gad65 picoband antibody.jpg

GAD65 was detected in paraffin-embedded sections of human mammary cancer tissues using rabbit anti- GAD65 Antigen Affinity purified polyclonal antibody (Catalog #) at 1 μg/mL. The immunohistochemical section was developed using SABC method (Catalog # SA1022).

Target Info

Protein Target Info (Source: Uniprot.org)

Uniprot Id Q05329
Gene Name GAD2
Protein Name Glutamate decarboxylase 2
Alternative Names Glutamate decarboxylase 2;4.1.1.15;65 kDa glutamic acid decarboxylase;GAD-65;Glutamate decarboxylase 65 kDa isoform;GAD2;GAD65;
Subcellular Localization Cytoplasm, cytosol . Cytoplasmic vesicle . Cell junction, synapse, presynaptic cell membrane ; Lipid-anchor . Golgi apparatus membrane ; Peripheral membrane protein ; Cytoplasmic side . Associated to cytoplasmic vesicles. In neurons, cytosolic leaflet of Golgi membranes and presynaptic clusters.
Molecular Weight 65411 MW

*if product is indicated to react with multiple species, protein info is based on the human gene.

Ontology

Protein Function Catalyzes the production of GABA.
Research Areas Amino Acid Metabolism, Amino Acids, Cancer, Metabolic Signaling Pathways, Metabolism, Neurology Process, Neuroscience, Neurotransmitter, Pathways And Processes

*You can search these to find other products in these research areas.
Background Glutamate decarboxylase 2, also known as GAD65, is an enzyme that in humans is encoded by the GAD2 gene. This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantibody and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Alternative splicing results in multiple transcript variants that encode the same protein.

Other Recommended Resources

Here are featured tools and databases that you might find useful.

Order Product (A03142)

Promotion:

Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.

$50 fee for conjugation. Antibody size is reduced to 50ug.

Option Price
30ug sample size $99
100ug $280
100ug+Free HRP Secondary BA1054 $280
100ug+Free Biotin Secondary BA1003 $280

USD $280

Ships in 7-10 business days.

Troubleshooting

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

We promise all of our products perform as described in datasheets.

Write a review for A03142

Publications

Acrylamide neurotoxicity on the cerebrum of weaning rats
Acrylamide neurotoxicity on the cerebrum of weaning rats