Anti-Integrin alpha2 ITGA2 Antibody

Product Name

Anti-Integrin alpha2 ITGA2 Antibody

View all Integrin alpha 2/CD49b Antibodies

SKU/Catalog Number

A01933

Size

100μl

Form

Liquid

Description

Boster Bio Anti-Integrin alpha2 ITGA2 Antibody catalog # A01933. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20°C for one year. For short term storage and frequent use, store at 4°C for up to one month. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Integrin alpha2 ITGA2 Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01933)

Host

Rabbit

Contents

Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.

Clonality

Polyclonal

Isotype

IgG

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse Synthetic peptide NSSAPGKPKTGKKSKQQTFIKPSPEEAQLWAEAFDELLASKYGLAAFRAF

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross reactivity with other proteins.

Reactive Species

A01933 is reactive to ITGA2 in Human, Mouse, Rat

Applications

A01933 is guaranteed for IHC, WB Boster Guarantee

Observed Molecular Weight

39 kDa

Calculated molecular weight

129.295kDa

Background of Integrin alpha 2/CD49b

CaM Kinase IV (also known as CAM kinase-GR and CaMK IV) is a calcium/ calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade. This kinase may be involved in the transcriptional regulation of microtubule dynamics. In vitro, CaMK IV phosphorylates CREB1, CREBBP, PRM2, MEF2A, MEF2D and STMN1/OP18. CaMK IV may also be involved in spermatogenesis and may play a role in the consolidation/ retention of hippocampus-dependent long-term memory. CaMK IV must be phosphorylated to be maximally active and is phosphorylated by CAMKK1 or CAMKK2. In addition autophosphorylation of the N-terminus is required for full activation. Autophosphorylation of Ser-336 allows the kinase to switch to a Ca(2+)/calmodulin-independent state. Most likely the kinase is inactivated by the serine/ threonine protein phosphatase 2A. CaMK IV is a monomer that is located within the cytoplasm and nucleus and substantial localization occurs in certain neuronal nuclei. In spermatids CaMK IV is associated with chromatin and the nuclear matrix. CaMK IV is also specifically expressed in epithelial ovarian cancer tissue.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Restore with deionized water (or equivalent) for reconstitution volume of 100 µL

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

WB, 1:500-1:2000
IHC-P, 1:100-1:300

Validation Images & Assay Conditions

Click image to see more details

Western Blot (WB) analysis of NIH-3T3 cells using Integrin alpha2 Polyclonal antibody.

Click image to see more details

Western Blot (WB) analysis of 3T3 cells using Integrin alpha2 Polyclonal antibody.

Click image to see more details

Immunohistochemistry (IHC) analysis of paraffin-embedded Human Colon, antibody was diluted at 1:100.

Gene/Protein Information For ITGA2 (Source: Uniprot.org, NCBI)

Alternative Names

alpha-2 subunit; CD49b antigen; CD49b; Integrin alpha 2; integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor); ITGA2; VLA 2; VLA-2 alpha ITGA2 BR, CD49B, GPIa, HPA-5, VLA-2, VLAA2 integrin subunit alpha 2 integrin alpha-2|CD49 antigen-like family member B|alpha 2 subunit of VLA-2 receptor|collagen receptor|human platelet alloantigen system 5|integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)|platelet antigen Br|platelet glycoprotein GPIa|platelet membrane glycoprotein Ia|very late activation protein 2 receptor, alpha-2 subunit

For more info on ITGA2, check out the ITGA2 Infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ITGA2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Take me to the ITGA2 Infographic

Here are featured tools and databases that you might find useful.

• Boster's Pathways Library
• Protein Databases
• Bioscience Research Protocol Resources
• Data Processing & Analysis Software
• Photo Editing Software
• Scientific Literature Resources
• Research Paper Management Tools
• Molecular Biology Software
• Primer Design Tools
• Bioinformatics Tools
• Phylogenetic Tree Analysis