Product Info Summary
SKU: | PB9899 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human |
Host: | Rabbit |
Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-TPP1 Antibody Picoband™
View all Tripeptidyl-Peptidase I/TPP1 Antibodies
SKU/Catalog Number
PB9899
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-TPP1 Antibody Picoband™ catalog # PB9899. Tested in IHC, WB applications. This antibody reacts with Human.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-TPP1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9899)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human TPP1, different from the related mouse sequence by six amino acids, and from the related rat sequence by five amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB9899 is reactive to TPP1 in Human
Applications
PB9899 is guaranteed for IHC, WB Boster Guarantee
Observed Molecular Weight
39 kDa
Calculated molecular weight
61.248kDa
Background of Tripeptidyl-Peptidase I/TPP1
Tripeptidyl-peptidase 1, also known as Lysosomal pepstatin-insensitive protease, is an enzyme that in humans is encoded by the TPP1 gene. This gene encodes a member of the sedolisin family of serine proteases. The protease functions in the lysosome to cleave N-terminal tripeptides from substrates, and has weaker endopeptidase activity. It is synthesized as a catalytically-inactive enzyme which is activated and auto-proteolyzed upon acidification. Mutations in this gene result in late-infantile neuronal ceroid lipofuscinosis, which is associated with the failure to degrade specific neuropeptides and a subunit of ATP synthase in the lysosome.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of TPP1 using anti-TPP1 antibody (PB9899).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: HELA whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-TPP1 antigen affinity purified polyclonal antibody (Catalog # PB9899) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for TPP1 at approximately 39 kDa. The expected band size for TPP1 is at 61 kDa.
Click image to see more details
Figure 2. IHC analysis of TPP1 using anti-TPP1 antibody (PB9899).
TPP1 was detected in a paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-TPP1 Antibody (PB9899) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For TPP1 (Source: Uniprot.org, NCBI)
Gene Name
TPP1
Full Name
Tripeptidyl-peptidase 1
Weight
61.248kDa
Alternative Names
Cell growth-inhibiting gene 1 protein; ceroid-lipofuscinosis, neuronal 2, late infantile (Jansky-Bielschowsky disease); CLN2; CLN2EC 3.4.14.9; growth-inhibiting protein 1; LINCL; LPIC; lysosomal pepstatin insensitive protease; Lysosomal pepstatin-insensitive protease; MGC21297; TPP1; TPP-1; TPP-I; Tripeptidyl aminopeptidase; tripeptidyl peptidase I; tripeptidyl-peptidase 1; TripeptidylPeptidase I; Tripeptidyl-Peptidase I TPP1 CLN2, GIG1, LPIC, SCAR7, TPP-1 tripeptidyl peptidase 1 tripeptidyl-peptidase 1|cell growth-inhibiting gene 1 protein|growth-inhibiting protein 1|lysosomal pepstatin insensitive protease|lysosomal pepstatin-insensitive carboxypeptidase|tripeptidyl aminopeptidase|tripeptidyl peptidase I
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on TPP1, check out the TPP1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for TPP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-TPP1 Antibody Picoband™ (PB9899)
Hello CJ!
No publications found for PB9899
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-TPP1 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Anti-TPP1 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
6 Customer Q&As for Anti-TPP1 Antibody Picoband™
Question
I am interested in to test anti-TPP1 antibody PB9899 on human adipose tissue for research purposes, then I may be interested in using anti-TPP1 antibody PB9899 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-08-30
Answer
The products we sell, including anti-TPP1 antibody PB9899, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-08-30
Question
Is this PB9899 anti-TPP1 antibody reactive to the isotypes of TPP1?
Verified Customer
Verified customer
Asked: 2019-05-24
Answer
The immunogen of PB9899 anti-TPP1 antibody is A synthetic peptide corresponding to a sequence in the middle region of human TPP1 (227-261aa CAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVV), different from the related mouse sequence by six amino acids, and from the related rat sequence by five amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-05-24
Question
We are currently using anti-TPP1 antibody PB9899 for human tissue, and we are content with the IHC results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on canine tissues as well?
S. Carter
Verified customer
Asked: 2019-04-16
Answer
The anti-TPP1 antibody (PB9899) has not been tested for cross reactivity specifically with canine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-04-16
Question
Do you have a BSA free version of anti-TPP1 antibody PB9899 available?
R. Zhang
Verified customer
Asked: 2016-03-07
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-TPP1 antibody PB9899 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2016-03-07
Question
Will anti-TPP1 antibody PB9899 work for IHC with adipose tissue?
E. Jha
Verified customer
Asked: 2015-01-23
Answer
According to the expression profile of adipose tissue, TPP1 is highly expressed in adipose tissue. So, it is likely that anti-TPP1 antibody PB9899 will work for IHC with adipose tissue.
Boster Scientific Support
Answered: 2015-01-23
Question
I see that the anti-TPP1 antibody PB9899 works with IHC, what is the protocol used to produce the result images on the product page?
F. Taylor
Verified customer
Asked: 2013-08-23
Answer
You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2013-08-23