Anti-Human Bcl-2 DyLight® 550 conjugated Antibody

Boster Bio Anti-Human Bcl-2 DyLight® 550 conjugated Antibody catalog # A00040-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human. Cited in 21 publication(s).

Product Info Summary

SKU: A00040-Dyl550
Size: 50ug/vial
Reactive Species: Human
Host: Rabbit
Application: Flow Cytometry

Product Name

Anti-Human Bcl-2 DyLight® 550 conjugated Antibody

See all Bcl-2 products

SKU/Catalog Number

A00040-Dyl550

Size

50ug/vial

Form

Liquid

Description

Boster Bio Anti-Human Bcl-2 DyLight® 550 conjugated Antibody catalog # A00040-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human.

Storage & Handling

At 2-8?C for one year from date of receipt. Protect from light. Do not freeze.

Cite This Product

Anti-Human Bcl-2 DyLight® 550 conjugated Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00040-Dyl550)

Host

Rabbit

Contents

Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human Bcl-2 (102-140aa DDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD), identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A00040-Dyl550 is reactive to BCL2 in Human

Applications

A00040-Dyl550 is guaranteed for Flow Cytometry Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Flow Cytometry, 1-3μg/1x106 cells

Validation Images & Assay Conditions

Gene/Protein Information For BCL2 (Source: Uniprot.Org, NCBI)

Uniprot ID

P10415

Gene ID

596

Gene Name

BCL2

Full Name

Apoptosis regulator Bcl-2

Weight

26.266kDa

Superfamily

Bcl-2 family

Alternative Names

apoptosis regulator Bcl-2; B-cell CLL/lymphoma 2; Bcl2; Bcl-2 BCL2 Bcl-2, PPP1R50 BCL2 apoptosis regulator apoptosis regulator Bcl-2|B-cell CLL/lymphoma 2|protein phosphatase 1, regulatory subunit 50

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on BCL2, check out the BCL2 Infographic

BCL2 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for BCL2: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

A00040-Dyl550 has been cited in 21 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Oleanolic acid from Prunella Vulgaris L. Induces SPC-A-1 cell line apoptosis via regulation of Bax, Bad and Bcl-2 Expression

Baicalin attenuates alcoholic liver injury through modulation of hepatic oxidative stress, inflammation and sonic hedgehog pathway in rats

Antitumor effects of Laminaria extract fucoxanthin on lung cancer

Recombinant Newcastle disease virus expressing human IFN%u2010%u03BB1 (rL%u2010hIFN%u2010%u03BB1)%u2010induced apoptosis of A549 cells is connected to endoplasmic reticulum stress %u2026

The inhibition effect of triptolide on human endometrial carcinoma cell line HEC-1B: A in vitro and in vivo studies

Ibutilide treatment protects against ER stress induced apoptosis by regulating calumenin expression in tunicamycin treated cardiomyocytes

NOB1 silencing inhibits the growth and metastasis of laryngeal cancer cells through the regulation of JNK signaling pathway

Transforming growth factor-beta1 suppresses hepatocellular carcinoma proliferation via activation of Hippo signaling

Reactive oxygen species-induced apoptosis in PC12 cells and protective effect of bilobalide

Myricetin exhibits anti-glioma potential by inducing mitochondrial-mediated apoptosis, cell cycle arrest, inhibition of cell migration and ROS generation

Copper ion attenuated the antiproliferative activity of di-2-pyridylhydrazone dithiocarbamate derivative; however, there was a lack of correlation between ROS %u2026

Laminarin%u2011induced apoptosis in human colon cancer LoVo cells

Reactive oxygen species mediate isoalantolactone-induced apoptosis in human prostate cancer cells

Ginsenoside-Rh2 inhibits proliferation and induces apoptosis of human gastric cancer SGC-7901 side population cells

Inhibition of cpu0213, a dual endothelin receptor antagonist, on apoptosis via nox4-dependent ros in hk-2 cells

Transcriptome analysis of Spodoptera frugiperda Sf9 cells reveals putative apoptosis-related genes and a preliminary apoptosis mechanism induced by %u2026

Correlation of acetabular chondrocyte apoptosis with caspase-3 and BCL-2 expression in developmental dislocations of the hip

Inhibitory effects of vitamin E on osteocyte apoptosis and DNA oxidative damage in bone marrow hemopoietic cells at early stage of steroid-induced femoral %u2026

Astaxanthin Inhibits Acetaldehyde-Induced Cytotoxicity in SH-SY5Y Cells by Modulating Akt/CREB and p38MAPK/ERK Signaling Pathways

Yang H, Wang C, Chen H, Li L, Ma S, Wang H, Fu Y, Qu T. Stem Cells Int. 2018 Apr 3;2018:4659159. doi: 10.1155/2018/4659159. eCollection 2018. Neural Stem Cell-Conditioned Medium Ameliorated Cerebral Ischemia-Reperfusion Injury in Rats

Chen Xl, Cao Lq, She Mr, Wang Q, Huang Xh, Fu Xh. World J Gastroenterol. 2008 Jan 28;14(4):582-9. Gli-1 Sirna Induced Apoptosis In Huh7 Cells.

Have you used Anti-Human Bcl-2 DyLight® 550 conjugated Antibody?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Human Bcl-2 DyLight® 550 conjugated Antibody

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

14 Customer Q&As for Anti-Human Bcl-2 DyLight® 550 conjugated Antibody

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for thyroid gland using anti-Human Bcl-2 DyLight® 550 conjugated antibody A00040-Dyl550. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2020-03-16

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-03-16

Question

Is there a BSA free version of anti-Human Bcl-2 DyLight® 550 conjugated antibody A00040-Dyl550 available?

Verified Customer

Verified customer

Asked: 2020-02-14

Answer

I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Human Bcl-2 DyLight® 550 conjugated antibody A00040-Dyl550 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-02-14

Question

Does anti-Human Bcl-2 DyLight® 550 conjugated antibody A00040-Dyl550 work for Flow Cytometry with thyroid gland?

Verified Customer

Verified customer

Asked: 2019-12-09

Answer

According to the expression profile of thyroid gland, BCL2 is highly expressed in thyroid gland. So, it is likely that anti-Human Bcl-2 DyLight® 550 conjugated antibody A00040-Dyl550 will work for Flow Cytometry with thyroid gland.

Boster Scientific Support

Answered: 2019-12-09

Question

We have seen staining in human testis. What should we do? Is anti-Human Bcl-2 DyLight® 550 conjugated antibody supposed to stain testis positively?

Verified Customer

Verified customer

Asked: 2019-11-29

Answer

From what I have seen in literature testis does express BCL2. From what I have seen in Uniprot.org, BCL2 is expressed in thyroid gland, testis, among other tissues. Regarding which tissues have BCL2 expression, here are a few articles citing expression in various tissues:
Testis, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2019-11-29

Question

We are currently using anti-Human Bcl-2 DyLight® 550 conjugated antibody A00040-Dyl550 for human tissue, and we are happy with the Flow Cytometry results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on pig tissues as well?

Verified Customer

Verified customer

Asked: 2019-10-31

Answer

The anti-Human Bcl-2 DyLight® 550 conjugated antibody (A00040-Dyl550) has not been tested for cross reactivity specifically with pig tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-10-31

Question

See attached the WB image, lot number and protocol we used for thyroid gland using anti-Human Bcl-2 DyLight® 550 conjugated antibody A00040-Dyl550. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-09-11

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-09-11

Question

My boss were satisfied with the WB result of your anti-Human Bcl-2 DyLight® 550 conjugated antibody. However we have been able to see positive staining in thyroid gland mitochondrion outer membrane using this antibody. Is that expected? Could you tell me where is BCL2 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-08-27

Answer

According to literature, thyroid gland does express BCL2. Generally BCL2 expresses in mitochondrion outer membrane. Regarding which tissues have BCL2 expression, here are a few articles citing expression in various tissues:
Testis, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2019-08-27

Question

I have a question about product A00040-Dyl550, anti-Human Bcl-2 DyLight® 550 conjugated antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-07-10

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00040-Dyl550 anti-Human Bcl-2 DyLight® 550 conjugated antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-07-10

Question

Would A00040-Dyl550 anti-Human Bcl-2 DyLight® 550 conjugated antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

J. Zhao

Verified customer

Asked: 2019-06-10

Answer

As indicated on the product datasheet, A00040-Dyl550 anti-Human Bcl-2 DyLight® 550 conjugated antibody as been validated on Flow Cytometry. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-06-10

Question

Our lab want to know about to test anti-Human Bcl-2 DyLight® 550 conjugated antibody A00040-Dyl550 on human thyroid gland for research purposes, then I may be interested in using anti-Human Bcl-2 DyLight® 550 conjugated antibody A00040-Dyl550 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-06-10

Answer

The products we sell, including anti-Human Bcl-2 DyLight® 550 conjugated antibody A00040-Dyl550, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-06-10

Question

Is a blocking peptide available for product anti-Human Bcl-2 DyLight® 550 conjugated antibody (A00040-Dyl550)?

K. Anderson

Verified customer

Asked: 2019-05-24

Answer

We do provide the blocking peptide for product anti-Human Bcl-2 DyLight® 550 conjugated antibody (A00040-Dyl550). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-05-24

Question

I see that the anti-Human Bcl-2 DyLight® 550 conjugated antibody A00040-Dyl550 works with Flow Cytometry, what is the protocol used to produce the result images on the product page?

M. Zhao

Verified customer

Asked: 2018-09-05

Answer

You can find protocols for Flow Cytometry on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2018-09-05

Question

I was wanting to use your anti-Human Bcl-2 DyLight® 550 conjugated antibody for Flow Cytometry for human thyroid gland on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human thyroid gland identification?

Verified Customer

Verified customer

Asked: 2017-06-20

Answer

You can see on the product datasheet, A00040-Dyl550 anti-Human Bcl-2 DyLight® 550 conjugated antibody has been tested for Flow Cytometry on human tissues. We have an innovator award program that if you test this antibody and show it works in human thyroid gland in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-06-20

Question

Is this A00040-Dyl550 anti-Human Bcl-2 DyLight® 550 conjugated antibody reactive to the isotypes of BCL2?

R. Moore

Verified customer

Asked: 2014-01-14

Answer

The immunogen of A00040-Dyl550 anti-Human Bcl-2 DyLight® 550 conjugated antibody is A synthetic peptide corresponding to a sequence in the middle region of human Bcl-2 (102-140aa DDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2014-01-14

$330

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
A00040-Dyl550
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$330.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.